4B18 - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF HUMAN IMPORTIN ALPHA 5 WITH TERT NLS PEPTIDE

Authors :   K. L. Kim, J. H. Yoo, H. S. Cho

Date :   08 Jul 12 (Deposition) - 04 Sep 13 (Release) - 01 Jul 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.52

Chains :   Asym./Biol. Unit : A,B

Keywords :   Transport Protein - Peptide Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. A. Jeong, K. Kim, J. H. Lee, J. S. Cha, P. Khadka, H. Cho, I. K. Chung
Akt-Mediated Phosphorylation Increases The Binding Affinity Of Htert For Importin Alpha To Promote Nuclear Translocation.
J. Cell. Sci. V. 128 2287 2015
PubMed-ID: 25999477 | Reference-DOI: 10.1242/JCS.166132

Molecule 1 - IMPORTIN SUBUNIT ALPHA-1
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21
	Expression System Taxid	:	511693
	Expression System Variant	:	CODON PLUS
	Expression System Vector	:	PET-28A
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 66-512
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	KARYOPHERIN SUBUNIT ALPHA-1, NUCLEOPROTEIN INTERACTOR 1, NPI-1, RAG COHORT PROTEIN 2, SRP1-BETA

Molecule 2 - TELOMERASE REVERSE TRANSCRIPTASE
	Chains	:	B
	EC Number	:	2.7.7.49
	Fragment	:	TERT NLS PEPTIDE, RESIDUES 222-240
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	HEST2, TELOMERASE CATALYTIC SUBUNIT, TELOMERASE-ASSOCIATED PROTEIN 2, TP2
	Synthetic	:	YES

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 4B18)

(no "Site" information available for 4B18)

(no "SS Bond" information available for 4B18)

Asymmetric/Biological Unit

No.	Residues
1	Pro A:79	-	Gly A:80
2	Ser A:244	-	Pro A:245

(no "SAP(SNP)/Variant" information available for 4B18)

Asymmetric/Biological Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARM_REPEAT	PS50176	Armadillo/plakoglobin ARM repeat profile.	IMA5_HUMAN	169-197 126-169 211-239 338-369	4	A:169-197 A:126-169 A:211-239 A:338-369

Asymmetric/Biological Unit (13, 13)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000310581	1b	ENSE00001340231	chr5:1295162-1294886	277	TERT_HUMAN	1-73	73	0	-	-
1.2b	ENST00000310581	2b	ENSE00001197112	chr5:1294781-1293428	1354	TERT_HUMAN	74-525	452	1	B:222-241 (gaps)	21
1.3b	ENST00000310581	3b	ENSE00001197095	chr5:1282739-1282544	196	TERT_HUMAN	525-590	66	0	-	-
1.4	ENST00000310581	4	ENSE00001083853	chr5:1280453-1280273	181	TERT_HUMAN	590-650	61	0	-	-
1.5	ENST00000310581	5	ENSE00001083857	chr5:1279585-1279406	180	TERT_HUMAN	651-710	60	0	-	-
1.6a	ENST00000310581	6a	ENSE00001320874	chr5:1278911-1278756	156	TERT_HUMAN	711-762	52	0	-	-
1.7	ENST00000310581	7	ENSE00001196926	chr5:1272395-1272300	96	TERT_HUMAN	763-794	32	0	-	-
1.8	ENST00000310581	8	ENSE00001196912	chr5:1271319-1271234	86	TERT_HUMAN	795-823	29	0	-	-
1.9	ENST00000310581	9	ENSE00001730462	chr5:1268748-1268635	114	TERT_HUMAN	823-861	39	0	-	-
1.10a	ENST00000310581	10a	ENSE00001721404	chr5:1266650-1266579	72	TERT_HUMAN	861-885	25	0	-	-
1.11a	ENST00000310581	11a	ENSE00001799173	chr5:1264707-1264519	189	TERT_HUMAN	885-948	64	0	-	-
1.12	ENST00000310581	12	ENSE00001663883	chr5:1260715-1260589	127	TERT_HUMAN	948-990	43	0	-	-
1.13	ENST00000310581	13	ENSE00001666436	chr5:1258774-1258713	62	TERT_HUMAN	991-1011	21	0	-	-
1.14	ENST00000310581	14	ENSE00001669116	chr5:1255526-1255402	125	TERT_HUMAN	1011-1053	43	0	-	-
1.15	ENST00000310581	15	ENSE00001694644	chr5:1254620-1254483	138	TERT_HUMAN	1053-1099	47	0	-	-
1.16c	ENST00000310581	16c	ENSE00001863787	chr5:1253946-1253282	665	TERT_HUMAN	1099-1132	34	0	-	-

2.1d	ENST00000344337	1d	ENSE00001856631	chr3:122233775-122233604	172	IMA5_HUMAN	-	0	0	-	-
2.3b	ENST00000344337	3b	ENSE00001370231	chr3:122215417-122215284	134	IMA5_HUMAN	1-43	43	0	-	-
2.4	ENST00000344337	4	ENSE00001078786	chr3:122186276-122186169	108	IMA5_HUMAN	44-79	36	1	A:79-79	1
2.6	ENST00000344337	6	ENSE00001078787	chr3:122182888-122182789	100	IMA5_HUMAN	80-113	34	1	A:80-113	34
2.7	ENST00000344337	7	ENSE00001801605	chr3:122180165-122180071	95	IMA5_HUMAN	113-144	32	1	A:113-144	32
2.10b	ENST00000344337	10b	ENSE00001150122	chr3:122172848-122172717	132	IMA5_HUMAN	145-188	44	1	A:145-188	44
2.11c	ENST00000344337	11c	ENSE00001150115	chr3:122170911-122170823	89	IMA5_HUMAN	189-218	30	1	A:189-218	30
2.12b	ENST00000344337	12b	ENSE00000776600	chr3:122170480-122170381	100	IMA5_HUMAN	218-251	34	1	A:218-251	34
2.13	ENST00000344337	13	ENSE00000776598	chr3:122168584-122168421	164	IMA5_HUMAN	252-306	55	1	A:252-306	55
2.14b	ENST00000344337	14b	ENSE00001650547	chr3:122160963-122160885	79	IMA5_HUMAN	306-332	27	1	A:306-332	27
2.15	ENST00000344337	15	ENSE00000776592	chr3:122156142-122156017	126	IMA5_HUMAN	333-374	42	1	A:333-374	42
2.16	ENST00000344337	16	ENSE00000776589	chr3:122152635-122152508	128	IMA5_HUMAN	375-417	43	1	A:375-417	43
2.17	ENST00000344337	17	ENSE00000776587	chr3:122146563-122146385	179	IMA5_HUMAN	417-477	61	1	A:417-477	61
2.18e	ENST00000344337	18e	ENSE00001154752	chr3:122146019-122140796	5224	IMA5_HUMAN	477-538	62	1	A:477-505	29

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:427
 aligned with IMA5_HUMAN | P52294 from UniProtKB/Swiss-Prot  Length:538

    Alignment length:427
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498       
           IMA5_HUMAN    79 PGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFG 505
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhh..hhhhhhhhhh....hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhhh..hhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------------------------------------------------------------ARM_REPEAT  PDB: A:169-197   -------------ARM_REPEAT  PDB: A:211-239   --------------------------------------------------------------------------------------------------ARM_REPEAT  PDB: A:338-369      ---------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------ARM_REPEAT  PDB: A:126-169 UniProt: 126-169 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
           Transcript 2 (1) 2Exon 2.6  PDB: A:80-113           -------------------------------Exon 2.10b  PDB: A:145-188 UniProt: 145-188 Exon 2.11c  PDB: A:189-218    ---------------------------------Exon 2.13  PDB: A:252-306 UniProt: 252-306             --------------------------Exon 2.15  PDB: A:333-374 UniProt: 333-374Exon 2.16  PDB: A:375-417 UniProt: 375-417 -----------------------------------------------------------Exon 2.18e  PDB: A:477-505    Transcript 2 (1)
           Transcript 2 (2) ----------------------------------Exon 2.7  PDB: A:113-144        -------------------------------------------------------------------------Exon 2.12b  PDB: A:218-251        ------------------------------------------------------Exon 2.14b  PDB: A:306-332 ------------------------------------------------------------------------------------Exon 2.17  PDB: A:417-477 UniProt: 417-477                   ---------------------------- Transcript 2 (2)
                 4b18 A  79 PGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFG 505
                                    88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438       448       458       468       478       488       498

Chain B from PDB  Type:PROTEIN  Length:16
 aligned with TERT_HUMAN | O14746 from UniProtKB/Swiss-Prot  Length:1132

    Alignment length:21
                                   231       241 
           TERT_HUMAN   222 RRRGGSASRSLPLPKRPRRGA 242
               SCOP domains --------------------- SCOP domains
               CATH domains --------------------- CATH domains
               Pfam domains --------------------- Pfam domains
         Sec.struct. author ...----............-. Sec.struct. author
                 SAPs(SNPs) --------------------- SAPs(SNPs)
                    PROSITE --------------------- PROSITE
               Transcript 1 Exon 1.2b             Transcript 1
                 4b18 B 222 RRR----SRSLPLPKRPRR-A 241
                              |    231        |-|
                            224  229        240 |
                                              241

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4B18)

(no "CATH Domain" information available for 4B18)

(no "Pfam Domain" information available for 4B18)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (IMA5_HUMAN | P52294)

molecular function
	GO:0008139	nuclear localization sequence binding	Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0006607	NLS-bearing protein import into nucleus	The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0006309	apoptotic DNA fragmentation	The cleavage of DNA during apoptosis, which usually occurs in two stages: cleavage into fragments of about 50 kbp followed by cleavage between nucleosomes to yield 200 bp fragments.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0019054	modulation by virus of host process	The process in which a virus effects a change in the processes and activities of its host organism.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0000018	regulation of DNA recombination	Any process that modulates the frequency, rate or extent of DNA recombination, a DNA metabolic process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (TERT_HUMAN | O14746)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0003968	RNA-directed 5'-3' RNA polymerase activity	Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
	GO:0003964	RNA-directed DNA polymerase activity	Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes RNA-template-directed extension of the 3'- end of a DNA strand by one deoxynucleotide at a time.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016779	nucleotidyltransferase activity	Catalysis of the transfer of a nucleotidyl group to a reactant.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0000049	tRNA binding	Interacting selectively and non-covalently with transfer RNA.
	GO:0070034	telomerase RNA binding	Interacting selectively and non-covalently with the telomerase RNA template.
	GO:0003721	telomerase RNA reverse transcriptase activity	Catalysis of the extension of the 3' end of a DNA strand by one deoxynucleotide at a time. Cannot initiate a chain de novo; uses the RNA subunit of the telomerase enzyme complex as its template.
	GO:0003720	telomerase activity	Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1). Catalyzes extension of the 3'- end of a DNA strand by one deoxynucleotide at a time using an internal RNA template that encodes the telomeric repeat sequence.
	GO:0042162	telomeric DNA binding	Interacting selectively and non-covalently with a telomere, a specific structure at the end of a linear chromosome required for the integrity and maintenance of the end.
	GO:0001223	transcription coactivator binding	Interacting selectively and non-covalently with a transcription coactivator, any protein involved in positive regulation of transcription via protein-protein interactions with transcription factors and other proteins that positively regulate transcription. Transcription coactivators do not bind DNA directly, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0071897	DNA biosynthetic process	The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
	GO:0022616	DNA strand elongation	The DNA metabolic process in which a DNA strand is synthesized by adding nucleotides to the 3' end of an existing DNA stand.
	GO:0032774	RNA biosynthetic process	The chemical reactions and pathways resulting in the formation of RNA, ribonucleic acid, one of the two main type of nucleic acid, consisting of a long, unbranched macromolecule formed from ribonucleotides joined in 3',5'-phosphodiester linkage. Includes polymerization of ribonucleotide monomers. Refers not only to transcription but also to e.g. viral RNA replication.
	GO:0006278	RNA-dependent DNA biosynthetic process	A DNA biosynthetic process that uses RNA as a template for RNA-dependent DNA polymerases (e.g. reverse transcriptase) that synthesize the new strand.
	GO:1904837	beta-catenin-TCF complex assembly	The aggregation, arrangement and bonding together of a set of components to form a beta-catenin-TCF complex.
	GO:0071456	cellular response to hypoxia	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0070200	establishment of protein localization to telomere	The directed movement of a protein to a specific location in the telomeric region of a chromosome.
	GO:0007005	mitochondrion organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
	GO:2000773	negative regulation of cellular senescence	Any process that stops, prevents or reduces the frequency, rate or extent of cellular senescence.
	GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	Any process that stops, prevents or reduces the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
	GO:0010629	negative regulation of gene expression	Any process that decreases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:1903704	negative regulation of production of siRNA involved in RNA interference	Any process that stops, prevents or reduces the frequency, rate or extent of production of siRNA involved in RNA interference.
	GO:0030177	positive regulation of Wnt signaling pathway	Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
	GO:0042635	positive regulation of hair cycle	Any process that activates or increases the frequency, rate or extent of the cyclical phases of growth (anagen), regression (catagen), quiescence (telogen), and shedding (exogen) in the life of a hair.
	GO:0051000	positive regulation of nitric-oxide synthase activity	Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
	GO:1902895	positive regulation of pri-miRNA transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of pri-miRNA transcription from RNA polymerase II promoter.
	GO:0032092	positive regulation of protein binding	Any process that activates or increases the frequency, rate or extent of protein binding.
	GO:1904751	positive regulation of protein localization to nucleolus	Any process that activates or increases the frequency, rate or extent of protein localization to nucleolus.
	GO:2000648	positive regulation of stem cell proliferation	Any process that activates or increases the frequency, rate or extent of stem cell proliferation.
	GO:0030422	production of siRNA involved in RNA interference	Cleavage of double-stranded RNA to form small interfering RNA molecules (siRNAs) of 21-23 nucleotides, in the context of RNA interference.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0090399	replicative senescence	A cell aging process associated with the dismantling of a cell as a response to telomere shortening and/or cellular aging.
	GO:0000723	telomere maintenance	Any process that contributes to the maintenance of proper telomeric length and structure by affecting and monitoring the activity of telomeric proteins, the length of telomeric DNA and the replication and repair of the DNA. These processes includes those that shorten, lengthen, replicate and repair the telomeric DNA sequences.
	GO:0007004	telomere maintenance via telomerase	The maintenance of proper telomeric length by the addition of telomeric repeats by telomerase.
	GO:0001172	transcription, RNA-templated	The cellular synthesis of RNA on a template of RNA.
cellular component
	GO:0016605	PML body	A class of nuclear body; they react against SP100 auto-antibodies (PML, promyelocytic leukemia); cells typically contain 10-30 PML bodies per nucleus; alterations in the localization of PML bodies occurs after viral infection.
	GO:0031379	RNA-directed RNA polymerase complex	A protein complex that possesses RNA-directed RNA polymerase activity.
	GO:1990572	TERT-RMRP complex	A ribonucleoprotein complex that has RNA-directed RNA polymerase (RdRP) activity, and is composed of telomerase reverse transcriptase (TERT) and the non-coding RNA component of mitochondrial RNA processing endoribonuclease (RMRP).
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000781	chromosome, telomeric region	The terminal region of a linear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030529	intracellular ribonucleoprotein complex	An intracellular macromolecular complex containing both protein and RNA molecules.
	GO:0042645	mitochondrial nucleoid	The region of a mitochondrion to which the DNA is confined.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0000784	nuclear chromosome, telomeric region	The terminal region of a linear nuclear chromosome that includes the telomeric DNA repeats and associated proteins.
	GO:0000783	nuclear telomere cap complex	A complex of DNA and protein located at the end of a linear chromosome in the nucleus that protects and stabilizes a linear chromosome.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0000333	telomerase catalytic core complex	The minimal catalytic core of telomerase is a ribonucleoprotein complex composed of a catalytic reverse transcriptase subunit and an RNA subunit that provides the template for telomeric DNA addition.
	GO:0005697	telomerase holoenzyme complex	Telomerase is a ribonucleoprotein enzyme complex, with a minimal catalytic core composed of a catalytic reverse transcriptase subunit and an RNA subunit that provides the template for telomeric DNA addition. In vivo, the holoenzyme complex often contains additional subunits.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 4b18)

	Sites
(no "Sites" information available for 4b18)

	Cis Peptide Bonds
		Pro A:79 - Gly A:80	[ RasMol ]
		Ser A:244 - Pro A:245	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4b18
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMA5_HUMAN \| P52294
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TERT_HUMAN \| O14746
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.7.49
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMA5_HUMAN \| P52294
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TERT_HUMAN \| O14746
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IMA5_HUMAN \| P52294	:	2jdq 3tj3
	TERT_HUMAN \| O14746	:	2bck 4mnq 5men 5meo 5mep 5meq 5mer 5ugw

2bck	CRYSTAL STRUCTURE OF HLA-A*2402 COMPLEXED WITH A TELOMERASE PEPTIDE
2jdq	C-TERMINAL DOMAIN OF INFLUENZA A VIRUS POLYMERASE PB2 SUBUNIT IN COMPLEX WITH HUMAN IMPORTIN ALPHA5

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 4)

Exons (13, 13)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (70, 74)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File