3TJ3 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF IMPORTIN A5 BOUND TO THE N-TERMINUS OF NUP50

Authors :   R. Pumroy, J. D. Nardozzi, D. J. Hart, M. J. Root, G. Cingolani

Date :   23 Aug 11 (Deposition) - 30 Nov 11 (Release) - 11 Feb 15 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.70

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Armadillo Repeat, Nuclear Import Adaptor, Nls-Bearing Proteins, Nucleo-Cytoplasmic Shuttling, Protein Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. A. Pumroy, J. D. Nardozzi, D. J. Hart, M. J. Root, G. Cingolani
Nucleoporin Nup50 Stabilizes Closed Conformation Of Armadillo Repeat 10 In Importin Alpha 5.
J. Biol. Chem. V. 287 2022 2012
PubMed-ID: 22130666 | Reference-DOI: 10.1074/JBC.M111.315838

Molecule 1 - IMPORTIN SUBUNIT ALPHA-1
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 66-512
	Gene	:	KPNA1, RCH2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IMPORTIN ALPHA 5, KARYOPHERIN SUBUNIT ALPHA-1, NUCLEOPROTEIN INTERACTOR 1, NPI-1, RAG COHORT PROTEIN 2, SRP1-BETA

Molecule 2 - NUCLEAR PORE COMPLEX PROTEIN NUP50
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	N-TERMINAL DOMAIN (UNP RESIDUES 1-109)
	Gene	:	NUP50, NPAP60L, PRO1146
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	50 KDA NUCLEOPORIN, NUCLEAR PORE-ASSOCIATED PROTEIN 60 KDA- LIKE, NUCLEOPORIN NUP50

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3TJ3)

(no "Site" information available for 3TJ3)

(no "SS Bond" information available for 3TJ3)

Asymmetric Unit

No.	Residues
1	Ser A:244	-	Pro A:245
2	Gly A:462	-	Thr A:463
3	Ser B:244	-	Pro B:245

(no "SAP(SNP)/Variant" information available for 3TJ3)

Asymmetric Unit (1, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARM_REPEAT	PS50176	Armadillo/plakoglobin ARM repeat profile.	IMA5_HUMAN	169-197 126-169 211-239 338-369	8	A:169-197 B:169-197 A:126-169 B:126-169 A:211-239 B:211-239 A:338-369 B:338-369

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARM_REPEAT	PS50176	Armadillo/plakoglobin ARM repeat profile.	IMA5_HUMAN	169-197 126-169 211-239 338-369	4	A:169-197 - A:126-169 - A:211-239 - A:338-369 -

Biological Unit 2 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ARM_REPEAT	PS50176	Armadillo/plakoglobin ARM repeat profile.	IMA5_HUMAN	169-197 126-169 211-239 338-369	4	- B:169-197 - B:126-169 - B:211-239 - B:338-369

Asymmetric Unit (13, 26)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1d	ENST00000344337	1d	ENSE00001856631	chr3:122233775-122233604	172	IMA5_HUMAN	-	0	0	-	-
1.3b	ENST00000344337	3b	ENSE00001370231	chr3:122215417-122215284	134	IMA5_HUMAN	1-43	43	0	-	-
1.4	ENST00000344337	4	ENSE00001078786	chr3:122186276-122186169	108	IMA5_HUMAN	44-79	36	0	-	-
1.6	ENST00000344337	6	ENSE00001078787	chr3:122182888-122182789	100	IMA5_HUMAN	80-113	34	2	A:82-113 B:82-113	32 32
1.7	ENST00000344337	7	ENSE00001801605	chr3:122180165-122180071	95	IMA5_HUMAN	113-144	32	2	A:113-144 B:113-144	32 32
1.10b	ENST00000344337	10b	ENSE00001150122	chr3:122172848-122172717	132	IMA5_HUMAN	145-188	44	2	A:145-188 B:145-188	44 44
1.11c	ENST00000344337	11c	ENSE00001150115	chr3:122170911-122170823	89	IMA5_HUMAN	189-218	30	2	A:189-218 B:189-218	30 30
1.12b	ENST00000344337	12b	ENSE00000776600	chr3:122170480-122170381	100	IMA5_HUMAN	218-251	34	2	A:218-251 B:218-251	34 34
1.13	ENST00000344337	13	ENSE00000776598	chr3:122168584-122168421	164	IMA5_HUMAN	252-306	55	2	A:252-306 B:252-306	55 55
1.14b	ENST00000344337	14b	ENSE00001650547	chr3:122160963-122160885	79	IMA5_HUMAN	306-332	27	2	A:306-332 B:306-332	27 27
1.15	ENST00000344337	15	ENSE00000776592	chr3:122156142-122156017	126	IMA5_HUMAN	333-374	42	2	A:333-374 B:333-374	42 42
1.16	ENST00000344337	16	ENSE00000776589	chr3:122152635-122152508	128	IMA5_HUMAN	375-417	43	2	A:375-417 B:375-417	43 43
1.17	ENST00000344337	17	ENSE00000776587	chr3:122146563-122146385	179	IMA5_HUMAN	417-477	61	2	A:417-477 B:417-477	61 61
1.18e	ENST00000344337	18e	ENSE00001154752	chr3:122146019-122140796	5224	IMA5_HUMAN	477-538	62	2	A:477-507 B:477-507	31 31

2.1a	ENST00000347635	1a	ENSE00001185148	chr22:45559722-45560177	456	NUP50_HUMAN	-	0	0	-	-
2.5d	ENST00000347635	5d	ENSE00002142994	chr22:45564049-45564127	79	NUP50_HUMAN	1-23	23	2	C:1-23 D:1-23	23 23
2.7c	ENST00000347635	7c	ENSE00001748959	chr22:45567481-45567564	84	NUP50_HUMAN	24-51	28	2	C:24-47 D:24-46	24 23
2.8c	ENST00000347635	8c	ENSE00000657043	chr22:45571775-45571961	187	NUP50_HUMAN	52-114	63	0	-	-
2.9e	ENST00000347635	9e	ENSE00001660061	chr22:45574119-45574781	663	NUP50_HUMAN	114-335	222	0	-	-
2.11	ENST00000347635	11	ENSE00001697601	chr22:45577167-45577248	82	NUP50_HUMAN	335-362	28	0	-	-
2.12b	ENST00000347635	12b	ENSE00001797834	chr22:45579283-45579401	119	NUP50_HUMAN	362-402	41	0	-	-
2.12h	ENST00000347635	12h	ENSE00001300233	chr22:45580334-45583892	3559	NUP50_HUMAN	402-468	67	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:426
 aligned with IMA5_HUMAN | P52294 from UniProtKB/Swiss-Prot  Length:538

    Alignment length:426
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501      
           IMA5_HUMAN    82 VITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTE 507
               SCOP domains d3tj3a_ A: automated matches                                                                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------------------------------------------ARM_REPEAT  PDB: A:169-197   -------------ARM_REPEAT  PDB: A:211-239   --------------------------------------------------------------------------------------------------ARM_REPEAT  PDB: A:338-369      ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) --------------------------------------------ARM_REPEAT  PDB: A:126-169 UniProt: 126-169 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.6  PDB: A:82-113         -------------------------------Exon 1.10b  PDB: A:145-188 UniProt: 145-188 Exon 1.11c  PDB: A:189-218    ---------------------------------Exon 1.13  PDB: A:252-306 UniProt: 252-306             --------------------------Exon 1.15  PDB: A:333-374 UniProt: 333-374Exon 1.16  PDB: A:375-417 UniProt: 375-417 -----------------------------------------------------------Exon 1.18e  PDB: A:477-507      Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.7  PDB: A:113-144        -------------------------------------------------------------------------Exon 1.12b  PDB: A:218-251        ------------------------------------------------------Exon 1.14b  PDB: A:306-332 ------------------------------------------------------------------------------------Exon 1.17  PDB: A:417-477 UniProt: 417-477                   ------------------------------ Transcript 1 (2)
                 3tj3 A  82 VITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTE 507
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501

Chain B from PDB  Type:PROTEIN  Length:426
 aligned with IMA5_HUMAN | P52294 from UniProtKB/Swiss-Prot  Length:538

    Alignment length:426
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501      
           IMA5_HUMAN    82 VITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTE 507
               SCOP domains d3tj3b_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhh.hhhhhhhhhhhhhhhhh.....hhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.hhhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhhh......hhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ---------------------------------------------------------------------------------------ARM_REPEAT  PDB: B:169-197   -------------ARM_REPEAT  PDB: B:211-239   --------------------------------------------------------------------------------------------------ARM_REPEAT  PDB: B:338-369      ------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (1)
                PROSITE (2) --------------------------------------------ARM_REPEAT  PDB: B:126-169 UniProt: 126-169 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.6  PDB: B:82-113         -------------------------------Exon 1.10b  PDB: B:145-188 UniProt: 145-188 Exon 1.11c  PDB: B:189-218    ---------------------------------Exon 1.13  PDB: B:252-306 UniProt: 252-306             --------------------------Exon 1.15  PDB: B:333-374 UniProt: 333-374Exon 1.16  PDB: B:375-417 UniProt: 375-417 -----------------------------------------------------------Exon 1.18e  PDB: B:477-507      Transcript 1 (1)
           Transcript 1 (2) -------------------------------Exon 1.7  PDB: B:113-144        -------------------------------------------------------------------------Exon 1.12b  PDB: B:218-251        ------------------------------------------------------Exon 1.14b  PDB: B:306-332 ------------------------------------------------------------------------------------Exon 1.17  PDB: B:417-477 UniProt: 417-477                   ------------------------------ Transcript 1 (2)
                 3tj3 B  82 VITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTE 507
                                    91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501

Chain C from PDB  Type:PROTEIN  Length:51
 aligned with NUP50_HUMAN | Q9UKX7 from UniProtKB/Swiss-Prot  Length:468

    Alignment length:51
                                1                                              
                                |    6        16        26        36        46 
          NUP50_HUMAN     - ----MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRN  47
               SCOP domains --------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------- PROSITE
               Transcript 2 ----Exon 2.5d  PDB: C:1-23 Exon 2.7c  PDB: C:24-47  Transcript 2
                 3tj3 C  -3 PLGSMAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRRN  47
                                     6        16        26        36        46

Chain D from PDB  Type:PROTEIN  Length:50
 aligned with NUP50_HUMAN | Q9UKX7 from UniProtKB/Swiss-Prot  Length:468

    Alignment length:50
                                1                                             
                                |    6        16        26        36        46
          NUP50_HUMAN     - ----MAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRR  46
               SCOP domains -------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------- Pfam domains
         Sec.struct. author ..................................hhhhhhhh........ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------- PROSITE
               Transcript 2 ----Exon 2.5d  PDB: D:1-23 Exon 2.7c  PDB: D:24-46 Transcript 2
                 3tj3 D  -3 PLGSMAKRNAEKELTDRNWDQEDEAEEVGTFSMASEEVLKNRAIKKAKRR  46
                                     6        16        26        36        46

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: ARM repeat (317)

Family: automated matches (39)

Protein domain: automated matches (39)

Human (Homo sapiens) [TaxId: 9606] (21)

1a	d3tj3a_	A:
1b	d3tj3b_	B:

(no "CATH Domain" information available for 3TJ3)

(no "Pfam Domain" information available for 3TJ3)

Asymmetric Unit(hide GO term definitions)

Chain A,B (IMA5_HUMAN | P52294)

molecular function
	GO:0008139	nuclear localization sequence binding	Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008565	protein transporter activity	Enables the directed movement of proteins into, out of or within a cell, or between cells.
biological process
	GO:0006607	NLS-bearing protein import into nucleus	The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0006309	apoptotic DNA fragmentation	The cleavage of DNA during apoptosis, which usually occurs in two stages: cleavage into fragments of about 50 kbp followed by cleavage between nucleosomes to yield 200 bp fragments.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0019054	modulation by virus of host process	The process in which a virus effects a change in the processes and activities of its host organism.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0000018	regulation of DNA recombination	Any process that modulates the frequency, rate or extent of DNA recombination, a DNA metabolic process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0030425	dendrite	A neuron projection that has a short, tapering, often branched, morphology, receives and integrates signals from other neurons or from sensory stimuli, and conducts a nerve impulse towards the axon or the cell body. In most neurons, the impulse is conveyed from dendrites to axon via the cell body, but in some types of unipolar neuron, the impulse does not travel via the cell body.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,D (NUP50_HUMAN | Q9UKX7)

molecular function
	GO:0008536	Ran GTPase binding	Interacting selectively and non-covalently with Ran, a conserved Ras-like GTP-binding protein, implicated in nucleocytoplasmic transport, cell cycle progression, spindle assembly, nuclear organization and nuclear envelope (NE) assembly.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0031047	gene silencing by RNA	Any process in which RNA molecules inactivate expression of target genes.
	GO:0046907	intracellular transport	The directed movement of substances within a cell.
	GO:0075733	intracellular transport of virus	The directed movement of a virus, or part of a virus, within the host cell.
	GO:0006406	mRNA export from nucleus	The directed movement of mRNA from the nucleus to the cytoplasm.
	GO:0051028	mRNA transport	The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0007077	mitotic nuclear envelope disassembly	The cell cycle process in which the controlled breakdown of the nuclear envelope during mitotic cell division occurs.
	GO:0006606	protein import into nucleus	The directed movement of a protein from the cytoplasm to the nucleus.
	GO:0016925	protein sumoylation	The process in which a SUMO protein (small ubiquitin-related modifier) is conjugated to a target protein via an isopeptide bond between the carboxyl terminus of SUMO with an epsilon-amino group of a lysine residue of the target protein.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:1900034	regulation of cellular response to heat	Any process that modulates the frequency, rate or extent of cellular response to heat.
	GO:0010827	regulation of glucose transport	Any process that modulates the frequency, rate or extent of glucose transport. Glucose transport is the directed movement of the hexose monosaccharide glucose into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006409	tRNA export from nucleus	The directed movement of tRNA from the nucleus to the cytoplasm.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019083	viral transcription	The process by which a viral genome, or part of a viral genome, is transcribed within the host cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005643	nuclear pore	Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3tj3)

	Sites
(no "Sites" information available for 3tj3)

	Cis Peptide Bonds
		Gly A:462 - Thr A:463	[ RasMol ]
		Ser A:244 - Pro A:245	[ RasMol ]
		Ser B:244 - Pro B:245	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3tj3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMA5_HUMAN \| P52294
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	NUP50_HUMAN \| Q9UKX7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMA5_HUMAN \| P52294
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	NUP50_HUMAN \| Q9UKX7
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IMA5_HUMAN \| P52294	:	2jdq 4b18
	NUP50_HUMAN \| Q9UKX7	:	2ec1

2c1t	STRUCTURE OF THE KAP60P:NUP2 COMPLEX
2jdq	C-TERMINAL DOMAIN OF INFLUENZA A VIRUS POLYMERASE PB2 SUBUNIT IN COMPLEX WITH HUMAN IMPORTIN ALPHA5

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 8)

Exons (13, 26)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (31, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File