Chain A from PDB Type:PROTEIN Length:76
SCOP domains ---------------------------------------------------------------------------- SCOP domains
CATH domains ---------------------------------------------------------------------------- CATH domains
Pfam domains ---------------------------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhh.hhhhhhhhhhhhhh. Sec.struct. author
SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ---------------------------------------------------------------------------- PROSITE
Transcript ---------------------------------------------------------------------------- Transcript
4x4e A 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK 77
11 21 31 41 51 61 71
Chain B from PDB Type:PROTEIN Length:77
SCOP domains ----------------------------------------------------------------------------- SCOP domains
CATH domains ----------------------------------------------------------------------------- CATH domains
Pfam domains ----------------------------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhh.. Sec.struct. author
SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ----------------------------------------------------------------------------- PROSITE
Transcript ----------------------------------------------------------------------------- Transcript
4x4e B 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKH 78
11 21 31 41 51 61 71
Chain C from PDB Type:PROTEIN Length:77
SCOP domains ----------------------------------------------------------------------------- SCOP domains
CATH domains ----------------------------------------------------------------------------- CATH domains
Pfam domains ----------------------------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhh..hhhhhhhhhhhhhh.. Sec.struct. author
SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ----------------------------------------------------------------------------- PROSITE
Transcript ----------------------------------------------------------------------------- Transcript
4x4e C 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKH 78
11 21 31 41 51 61 71
Chain D from PDB Type:PROTEIN Length:76
SCOP domains ---------------------------------------------------------------------------- SCOP domains
CATH domains ---------------------------------------------------------------------------- CATH domains
Pfam domains ---------------------------------------------------------------------------- Pfam domains
Sec.struct. author .hhhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhh. Sec.struct. author
SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
PROSITE ---------------------------------------------------------------------------- PROSITE
Transcript ---------------------------------------------------------------------------- Transcript
4x4e D 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK 77
11 21 31 41 51 61 71
Chain E from PDB Type:DNA Length:35
4x4e E 1 ATGTGACTTATAGTCCGTGTGATTATAGTCAACAT 35
10 20 30
Chain F from PDB Type:DNA Length:35
4x4e F 1 ATGTTGACTATAATCACACGGACTATAAGTCACAT 35
10 20 30
| Legend: |
|
→ Mismatch |
(orange background) |
| |
- |
→ Gap |
(green background, '-', border residues have a numbering label) |
| |
|
→ Modified Residue |
(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name) |
| |
x |
→ Chemical Group |
(purple background, 'x', labelled with number + name, e.g. ACE or NH2) |
| |
extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|' |