|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3FYA) |
Sites (0, 0)| (no "Site" information available for 3FYA) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3FYA) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3FYA) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3FYA) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3FYA) |
Exons (0, 0)| (no "Exon" information available for 3FYA) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:75 aligned with Q8GGH0_9ENTR | Q8GGH0 from UniProtKB/TrEMBL Length:79 Alignment length:75 11 21 31 41 51 61 71 Q8GGH0_9ENTR 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEIL 76 SCOP domains d3fyaa_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------- Transcript 3fya A 2 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEIL 76 11 21 31 41 51 61 71 Chain B from PDB Type:PROTEIN Length:77 aligned with Q8GGH0_9ENTR | Q8GGH0 from UniProtKB/TrEMBL Length:79 Alignment length:77 12 22 32 42 52 62 72 Q8GGH0_9ENTR 3 SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 79 SCOP domains d3fyab_ B: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------- Transcript 3fya B 3 SFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDATYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILKHD 79 12 22 32 42 52 62 72
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3FYA) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3FYA) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q8GGH0_9ENTR | Q8GGH0)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|