Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  M3-MT4L RECEPTOR BOUND TO TIOTROPIUM
 
Authors :  T. S. Thorsen, R. Matt, W. I. Weis, B. Kobilka
Date :  15 Jul 14  (Deposition) - 26 Nov 14  (Release) - 24 Dec 14  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Gpcr T4L Stabillized Crystallography, Membrane Protein, Membrane Protein-Inhibitor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. S. Thorsen, R. Matt, W. I. Weis, B. K. Kobilka
Modified T4 Lysozyme Fusion Proteins Facilitate G Protein-Coupled Receptor Crystallogenesis.
Structure V. 22 1657 2014
PubMed-ID: 25450769  |  Reference-DOI: 10.1016/J.STR.2014.08.022

(-) Compounds

Molecule 1 - MUSCARINIC ACETYLCHOLINE RECEPTOR M3,LYSOZYME,MUSCARINIC ACETYLCHOLINE RECEPTOR M3
    ChainsA, B
    EC Number3.2.1.17
    EngineeredYES
    Expression SystemSPODOPTERA FRUGIPERDA
    Expression System Taxid7108
    FragmentUNP P08483 RESIDUES 57-259, 482-563, UNP D9IEF7 RESIDUES 61-161
    GeneCHRM3, CHRM-3, E, T4TP126
    Organism CommonRAT
    Organism ScientificRATTUS NORVEGICUS, ENTEROBACTERIA PHAGE T4
    Organism Taxid10116, 10665

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)A 
Biological Unit 2 (1x) B
Biological Unit 3 (1x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 12)

Asymmetric Unit (4, 12)
No.NameCountTypeFull Name
10HK2Ligand/Ion(1R,2R,4S,5S,7S)-7-{[HYDROXY(DITHIOPHEN-2-YL)ACETYL]OXY}-9,9-DIMETHYL-3-OXA-9-AZONIATRICYCLO[3.3.1.0~2,4~]NONANE
2OLC2Ligand/Ion(2R)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE
3P6G4Ligand/IonHEXAETHYLENE GLYCOL
4TAR4Ligand/IonD(-)-TARTARIC ACID
Biological Unit 1 (3, 6)
No.NameCountTypeFull Name
10HK1Ligand/Ion(1R,2R,4S,5S,7S)-7-{[HYDROXY(DITHIOPHEN-2-YL)ACETYL]OXY}-9,9-DIMETHYL-3-OXA-9-AZONIATRICYCLO[3.3.1.0~2,4~]NONANE
2OLC-1Ligand/Ion(2R)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE
3P6G3Ligand/IonHEXAETHYLENE GLYCOL
4TAR2Ligand/IonD(-)-TARTARIC ACID
Biological Unit 2 (4, 6)
No.NameCountTypeFull Name
10HK1Ligand/Ion(1R,2R,4S,5S,7S)-7-{[HYDROXY(DITHIOPHEN-2-YL)ACETYL]OXY}-9,9-DIMETHYL-3-OXA-9-AZONIATRICYCLO[3.3.1.0~2,4~]NONANE
2OLC2Ligand/Ion(2R)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE
3P6G1Ligand/IonHEXAETHYLENE GLYCOL
4TAR2Ligand/IonD(-)-TARTARIC ACID
Biological Unit 3 (4, 12)
No.NameCountTypeFull Name
10HK2Ligand/Ion(1R,2R,4S,5S,7S)-7-{[HYDROXY(DITHIOPHEN-2-YL)ACETYL]OXY}-9,9-DIMETHYL-3-OXA-9-AZONIATRICYCLO[3.3.1.0~2,4~]NONANE
2OLC2Ligand/Ion(2R)-2,3-DIHYDROXYPROPYL (9Z)-OCTADEC-9-ENOATE
3P6G4Ligand/IonHEXAETHYLENE GLYCOL
4TAR4Ligand/IonD(-)-TARTARIC ACID

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREASP A:147 , TYR A:148 , SER A:151 , ASN A:152 , TRP A:199 , THR A:231 , THR A:234 , ALA A:235 , ALA A:238 , PHE A:239 , TRP A:503 , TYR A:506 , ASN A:507 , TYR A:529 , CYS A:532binding site for residue 0HK A 2001
02AC2SOFTWAREGLY A:1014 , ALA A:1020 , PHE A:1024 , ASP B:1027 , VAL B:1060 , PHE B:1061 , GLY B:1064 , GLU B:1065binding site for residue P6G A 2002
03AC3SOFTWAREGLU A:1011 , VAL A:1060 , PHE A:1061 , GLN A:1062 , GLY A:1064 , ARG B:1008 , GLU B:1011 , GLY B:1013 , ASP B:1027binding site for residue P6G A 2003
04AC4SOFTWARETHR A:1066 , GLY A:1067 , GLY A:1070 , PHE A:1071 , TRP A:1095 , GLN A:1098 , LYS B:99 , ARG B:179binding site for residue P6G A 2004
05AC5SOFTWARETHR A:1099 , PRO A:1100 , ASN A:1101 , ARG A:1102 , THR B:1099 , PRO B:1100 , ASN B:1101binding site for residue TAR A 2005
06AC6SOFTWAREPHE A:1071 , THR A:1072 , ASN A:1073 , SER A:1074 , ASN A:1089binding site for residue TAR A 2006
07AC7SOFTWAREASP B:147 , TYR B:148 , SER B:151 , ASN B:152 , THR B:231 , ALA B:235 , ALA B:238 , PHE B:239 , TRP B:503 , TYR B:506 , ASN B:507 , TYR B:529 , CYS B:532 , TYR B:533binding site for residue 0HK B 1201
08AC8SOFTWARETHR B:244 , THR B:247 , TRP B:251binding site for residue OLC B 1202
09AC9SOFTWARESER B:493 , ALA B:494 , ILE B:534binding site for residue OLC B 1203
10AD1SOFTWAREPHE B:124 , LEU B:144 , TYR B:148 , PHE B:221 , ILE B:222 , LEU B:225 , TRP B:525 , TYR B:529binding site for residue P6G B 1204
11AD2SOFTWAREPHE B:1071 , THR B:1072 , ASN B:1073 , SER B:1074 , ASN B:1089binding site for residue TAR B 1205
12AD3SOFTWARETHR B:100 , VAL B:101 , ASN B:102 , ARG B:176 , ARG B:179binding site for residue TAR B 1206

(-) SS Bonds  (4, 4)

Asymmetric Unit
No.Residues
1A:140 -A:220
2A:516 -A:519
3B:140 -B:220
4B:516 -B:519

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Glu A:258 -Lys A:259
2Ser B:1015 -Gly B:1016
3Gly B:1016 -Gly B:1017

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4U15)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4U15)

(-) Exons   (0, 0)

(no "Exon" information available for 4U15)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:391
                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4u15 A   63 TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTL  557
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252      1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113    || 486       496       506       516       526       536       546       556 
                                                                                                                                                                                                                              259|                                                                                                                 1118|                                                                           
                                                                                                                                                                                                                              1001                                                                                                                   482                                                                           

Chain B from PDB  Type:PROTEIN  Length:392
                                                                                                                                                                                                                                                                                                                                                                                                                                         
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh....................hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh...hhhhhhh.hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                4u15 B   63 TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGGGSGGDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKTLL  558
                                    72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252      1003      1013      1023      1033      1043      1053      1063      1073      1083      1093      1103      1113    || 486       496       506       516       526       536       546       556  
                                                                                                                                                                                                                              259|                                                                                                                 1118|                                                                            
                                                                                                                                                                                                                              1001                                                                                                                   482                                                                            

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4U15)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4U15)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4U15)

(-) Gene Ontology  (38, 38)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    0HK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    OLC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    P6G  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TAR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Glu A:258 - Lys A:259   [ RasMol ]  
    Gly B:1016 - Gly B:1017   [ RasMol ]  
    Ser B:1015 - Gly B:1016   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4u15
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ACM3_RAT | P08483
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  D9IEF7_BPT4 | D9IEF7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.2.1.17
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ACM3_RAT | P08483
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  D9IEF7_BPT4 | D9IEF7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ACM3_RAT | P084832amk 4daj 4u14 4u16
        D9IEF7_BPT4 | D9IEF74s0w 5ndd 5ndz 5t1a 5v83 5v86 5v88 5vba 5xez 5xf1
UniProtKB/TrEMBL
        D9IEF7_BPT4 | D9IEF74pjz 4pk0 4pla 4qkx 4u16 4uis 4xsj 4yc4 5bz6 5i0n

(-) Related Entries Specified in the PDB File

4u14 4u16