4TSO - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF FRAC WITH DHPC BOUND (CRYSTAL FORM I)

Authors :   J. M. M. Caaveiro, K. Tanaka, K. Tsumoto

Date :   19 Jun 14 (Deposition) - 04 Mar 15 (Release) - 03 Aug 16 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Toxin, Actinoporin, Pore-Forming Toxin, Membrane Lipids, Phosphocholine, Lipid-Protein Interaction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Tanaka, J. M. M. Caaveiro, K. Morante, J. M. Gonzalez-Manas, K. Tsumoto
Structural Basis For Self-Assembly Of A Cytolytic Pore Line By Protein And Lipid
Nat Commun V. 6 6337 2015
PubMed-ID: 25716479 | Reference-DOI: 10.1038/NCOMMS7337
(for further references see the PDB file header)

Molecule 1 - FRAGACEATOXIN C
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEM-T
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Common	:	STRAWBERRY ANEMONE
	Organism Scientific	:	ACTINIA FRAGACEA
	Organism Taxid	:	396334
	Synonym	:	FRAC

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 14)

No.	Name	Count	Type	Full Name
1	HXG	5	Ligand/Ion	1,2-DIHEXANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
2	PO4	6	Ligand/Ion	PHOSPHATE ION
3	SO4	3	Ligand/Ion	SULFATE ION

Biological Unit 1 (3, 7)

No.	Name	Count	Type	Full Name
1	HXG	3	Ligand/Ion	1,2-DIHEXANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
2	PO4	3	Ligand/Ion	PHOSPHATE ION
3	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (3, 7)

No.	Name	Count	Type	Full Name
1	HXG	2	Ligand/Ion	1,2-DIHEXANOYL-SN-GLYCERO-3-PHOSPHOCHOLINE
2	PO4	3	Ligand/Ion	PHOSPHATE ION
3	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (14, 14)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	ASN A:111 , TRP A:112 , TYR A:113 , TRP A:116 , TYR A:137 , HOH A:311 , HOH A:321 , PRO B:81 , HOH B:317	binding site for residue HXG A 201
02	AC2	SOFTWARE	SER A:54 , ALA A:83 , GLY A:85 , SER A:105 , PRO A:107 , TYR A:108 , ASP A:109 , TYR A:113 , TYR A:133 , TYR A:137 , HXG A:203 , HOH A:310 , TRP B:112 , HXG B:201	binding site for residue HXG A 202
03	AC3	SOFTWARE	ARG A:53 , GLN A:130 , TYR A:133 , GLU A:134 , TYR A:138 , HXG A:202	binding site for residue HXG A 203
04	AC4	SOFTWARE	LYS A:30 , ARG A:31 , ASN B:28 , ARG B:79	binding site for residue SO4 A 204
05	AC5	SOFTWARE	ARG A:120 , TYR A:122 , LYS A:123	binding site for residue PO4 A 205
06	AC6	SOFTWARE	HIS A:139	binding site for residue PO4 A 206
07	AC7	SOFTWARE	ARG A:53 , GLY A:55 , ASN A:78 , VAL A:82 , THR A:84 , HOH A:345 , HOH A:346 , HOH A:348	binding site for residue PO4 A 207
08	AC8	SOFTWARE	TRP A:112 , HXG A:202 , SER B:54 , ALA B:83 , THR B:84 , GLY B:85 , SER B:105 , PRO B:107 , TYR B:108 , TRP B:112 , TYR B:113 , TYR B:133 , TYR B:137 , TYR B:138 , HXG B:202 , SO4 B:203 , HOH B:329 , HOH B:361	binding site for residue HXG B 201
09	AC9	SOFTWARE	TRP B:112 , TYR B:113 , TRP B:116 , TYR B:137 , HXG B:201 , HOH B:302	binding site for residue HXG B 202
10	AD1	SOFTWARE	ARG B:53 , GLN B:130 , TYR B:133 , TYR B:138 , HXG B:201 , HOH B:349	binding site for residue SO4 B 203
11	AD2	SOFTWARE	TYR A:110 , VAL B:29 , LYS B:30 , LYS B:77 , ARG B:79 , GLY B:80 , HOH B:313	binding site for residue SO4 B 204
12	AD3	SOFTWARE	ARG B:120 , VAL B:121 , TYR B:122 , LYS B:123 , TYR B:156	binding site for residue PO4 B 205
13	AD4	SOFTWARE	HIS B:63 , LYS B:64	binding site for residue PO4 B 206
14	AD5	SOFTWARE	LYS B:30 , ARG B:31 , HIS B:169	binding site for residue PO4 B 207

(no "SS Bond" information available for 4TSO)

(no "Cis Peptide Bond" information available for 4TSO)

(no "SAP(SNP)/Variant" information available for 4TSO)

(no "PROSITE Motif" information available for 4TSO)

(no "Exon" information available for 4TSO)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:177
                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eee.hhhhhhhhhhhhhhh.....eeeeeeee.....eeeeeeeeee.........ee...eeeeeeee.........eeeeeeeee....eeeeeeee.........eeeeeee......hhhhhhhhhhh...ee...eeeeeeee..eeeeeee....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tso A   3 DVAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTYFRSGTSDIVLPHKVAHGKALLYNGQKNRGPVATGVVGVIAYSMSDGNTLAVLFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHSRGLGYGLKSRGFMNSSGHAILEIHVTKA 179
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain B from PDB  Type:PROTEIN  Length:177
                                                                                                                                                                                                                 
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhhhhhhhhhh....eeeeeeee.....eeeeeeeeee.........ee...eeeeeeee.........eeeeeeeee....eeeeeeee.........eeeeeee......hhhhhhhhhhh...ee...eeeeeeee..eeeeeee....eeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4tso B   3 DVAGAVIDGAGLGFDVLKTVLEALGNVKRKIAVGIDNESGKTWTAMNTYFRSGTSDIVLPHKVAHGKALLYNGQKNRGPVATGVVGVIAYSMSDGNTLAVLFSVPYDYNWYSNWWNVRVYKGQKRADQRMYEELYYHRSPFRGDNGWHSRGLGYGLKSRGFMNSSGHAILEIHVTKA 179
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 4TSO)

(no "CATH Domain" information available for 4TSO)

(no "Pfam Domain" information available for 4TSO)

Asymmetric Unit(hide GO term definitions)

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HXG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		AD1	[ RasMol ]	+environment [ RasMol ]
		AD2	[ RasMol ]	+environment [ RasMol ]
		AD3	[ RasMol ]	+environment [ RasMol ]
		AD4	[ RasMol ]	+environment [ RasMol ]
		AD5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4tso)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4tso
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ACTPC_ACTFR \| B9W5G6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ACTPC_ACTFR \| B9W5G6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	ACTPC_ACTFR \| B9W5G6	:	3lim 3vwi 3w9p 3zwg 3zwj 4tsl 4tsn 4tsp 4tsq 4tsy 4wdc 5bpg 5gwf

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 14)

Sites (14, 14)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (16, 16)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File