4DSO - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   SMALL-MOLECULE LIGANDS BIND TO A DISTINCT POCKET IN RAS AND INHIBIT SOS-MEDIATED NUCLEOTIDE EXCHANGE ACTIVITY

Authors :   A. Oh, T. Maurer, L. S. Garrenton, K. Pitts, D. J. Anderson, N. J. Skelton B. P. Fauber, B. Pan, S. Malek, D. Stokoe, M. Ludlam, K. K. Bowman, J. Wu, A. M. Giannetti, M. A. Starovasnik, I. Mellman, P. K. Jackson, J. Ruldo G. Fang, W. Wang

Date :   19 Feb 12 (Deposition) - 04 Apr 12 (Release) - 06 Jun 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym./Biol. Unit : A

Keywords :   Small G-Protein, Signaling, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. Maurer, L. S. Garrenton, A. Oh, K. Pitts, D. J. Anderson, N. J. Skelton, B. P. Fauber, B. Pan, S. Malek, D. Stokoe, M. J. Ludlam, K. K. Bowman, J. Wu, A. M. Giannetti, M. A. Starovasnik, I. Mellman, P. K. Jackson, J. Rudolph, W. Wang, G. Fang
Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity.
Proc. Natl. Acad. Sci. Usa V. 109 5299 2012
PubMed-ID: 22431598 | Reference-DOI: 10.1073/PNAS.1116510109

Molecule 1 - GTPASE KRAS, ISOFORM 2B
	Chains	:	A
	EC Number	:	3.6.-.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	KRAS, KRAS2, RASK2
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	KRAS 4B, K-RAS 2, KI-RAS, C-K-RAS, C-KI-RAS, GTPASE KRAS, N- TERMINALLY PROCESSED

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (4, 4)

No.	Name	Count	Type	Full Name
1	BEN	1	Ligand/Ion	BENZAMIDINE
2	GOL	1	Ligand/Ion	GLYCEROL
3	GSP	1	Ligand/Ion	5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE
4	MG	1	Ligand/Ion	MAGNESIUM ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:12 , GLY A:13 , VAL A:14 , GLY A:15 , LYS A:16 , SER A:17 , ALA A:18 , PHE A:28 , VAL A:29 , ASP A:30 , GLU A:31 , TYR A:32 , THR A:35 , GLY A:60 , ASN A:116 , LYS A:117 , ASP A:119 , LEU A:120 , SER A:145 , ALA A:146 , LYS A:147 , MG A:202 , HOH A:322 , HOH A:347 , HOH A:366 , HOH A:419 , HOH A:429 , HOH A:436	BINDING SITE FOR RESIDUE GSP A 201
2	AC2	SOFTWARE	SER A:17 , THR A:35 , GSP A:201 , HOH A:322 , HOH A:366	BINDING SITE FOR RESIDUE MG A 202
3	AC3	SOFTWARE	LEU A:6 , SER A:39 , ARG A:41 , ASP A:54 , LEU A:56 , THR A:74 , CYS A:118 , HOH A:316 , HOH A:317	BINDING SITE FOR RESIDUE BEN A 203
4	AC4	SOFTWARE	GLU A:62 , ARG A:68 , ASP A:92 , HIS A:95 , TYR A:96 , GLN A:99 , HOH A:384	BINDING SITE FOR RESIDUE GOL A 204

(no "SS Bond" information available for 4DSO)

(no "Cis Peptide Bond" information available for 4DSO)

Asymmetric/Biological Unit (43, 43)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_065144	K	5	E	RASK_HUMAN	Disease (NS3)	193929331	A	K	5	E
02	UniProt	VAR_064849	K	5	N	RASK_HUMAN	Disease (GASC)	104894361	A	K	5	N
03	UniProt	VAR_036305	G	12	A	RASK_HUMAN	Unclassified	121913529	A	D	12	A
04	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_07 *	G	12	A	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	A
05	UniProt	VAR_006839	G	12	C	RASK_HUMAN	Unclassified	121913530	A	D	12	C
06	UniProt	VAR_016026	G	12	D	RASK_HUMAN	Disease (JMML)	121913529	A	D	12	D
07	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_02 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	D
08	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_03 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	D
09	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_08 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	D
10	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_09 *	G	12	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	D
11	UniProt	VAR_016027	G	12	R	RASK_HUMAN	Unclassified	121913530	A	D	12	R
12	UniProt	VAR_016028	G	12	S	RASK_HUMAN	Disease (JMML)	121913530	A	D	12	S
13	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_01 *	G	12	S	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	S
14	UniProt	VAR_006840	G	12	V	RASK_HUMAN	Disease (GASC)	121913529	A	D	12	V
15	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_04 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	V
16	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_05 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	V
17	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_06 *	G	12	V	RASK_HUMAN	Disease (Colorectal cancer)	---	A	D	12	V
18	UniProt	VAR_016029	G	13	D	RASK_HUMAN	Disease (JMML)	112445441	A	G	13	D
19	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_10 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
20	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_11 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
21	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_12 *	G	13	D	RASK_HUMAN	Disease (Colorectal cancer)	---	A	G	13	D
22	UniProt	VAR_065145	G	13	R	RASK_HUMAN	Polymorphism	121913535	A	G	13	R
23	UniProt	VAR_026109	V	14	I	RASK_HUMAN	Disease (NS3)	104894365	A	V	14	I
24	UniProt	VAR_064850	Q	22	E	RASK_HUMAN	Disease (CFC2)	---	A	Q	22	E
25	UniProt	VAR_064851	Q	22	R	RASK_HUMAN	Disease (NS3)	727503110	A	Q	22	R
26	UniProt	VAR_064852	P	34	L	RASK_HUMAN	Disease (NS3)	104894366	A	P	34	L
27	UniProt	VAR_064853	P	34	Q	RASK_HUMAN	Disease (NS3)	---	A	P	34	Q
28	UniProt	VAR_026110	P	34	R	RASK_HUMAN	Disease (CFC2)	104894366	A	P	34	R
29	UniProt	VAR_064854	I	36	M	RASK_HUMAN	Disease (NS3)	727503109	A	I	36	M
30	UniProt	VAR_026111	T	58	I	RASK_HUMAN	Disease (NS3)	104894364	A	T	58	I
31	UniProt	VAR_016030	A	59	T	RASK_HUMAN	Disease (GASC)	121913528	A	A	59	T
32	UniProt	VAR_026112	G	60	R	RASK_HUMAN	Disease (CFC2)	104894359	A	G	60	R
33	UniProt	VAR_065146	G	60	S	RASK_HUMAN	Disease (NS3)	104894359	A	G	60	S
34	UniProt	VAR_006841	Q	61	H	RASK_HUMAN	Unclassified	17851045	A	Q	61	H
35	UniProt	VAR_036306	Q	61	R	RASK_HUMAN	Unclassified	121913240	A	Q	61	R
36	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_13 *	Q	61	R	RASK_HUMAN	Disease (Colorectal cancer)	---	A	Q	61	R
37	UniProt	VAR_069784	Y	71	H	RASK_HUMAN	Disease (CFC2)	387907205	A	Y	71	H
38	UniProt	VAR_036307	K	117	N	RASK_HUMAN	Unclassified	770248150	A	K	117	N
39	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_14 *	K	117	N	RASK_HUMAN	Disease (Colorectal cancer)	---	A	K	117	N
40	UniProt	VAR_036308	A	146	T	RASK_HUMAN	Unclassified	121913527	A	A	146	T
41	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_15 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A	A	146	T
42	CancerSNP	VAR_RASK_HUMAN_CCDS8702_1_16 *	A	146	T	RASK_HUMAN	Disease (Colorectal cancer)	---	A	A	146	T
43	UniProt	VAR_069785	K	147	E	RASK_HUMAN	Disease (CFC2)	387907206	A	K	147	E
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RAS	PS51421	small GTPase Ras family profile.	RASK_HUMAN	1-189	1	A:2-180

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000256078	1	ENSE00001189804	chr12:25403854-25403685	170	RASK_HUMAN	-	0	0	-	-
1.2a	ENST00000256078	2a	ENSE00000936617	chr12:25398329-25398208	122	RASK_HUMAN	1-37	37	1	A:1-37	37
1.3	ENST00000256078	3	ENSE00001719809	chr12:25380346-25380168	179	RASK_HUMAN	38-97	60	1	A:38-97	60
1.4	ENST00000256078	4	ENSE00001644818	chr12:25378707-25378548	160	RASK_HUMAN	97-150	54	1	A:97-150	54
1.5b	ENST00000256078	5b	ENSE00001189807	chr12:25368494-25368371	124	RASK_HUMAN	151-189	39	1	A:151-180 (gaps)	35
1.6b	ENST00000256078	6b	ENSE00001740851	chr12:25362845-25358182	4664	RASK_HUMAN	-	0	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:180
 aligned with RASK_HUMAN | P01116 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
           RASK_HUMAN     1 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKK 185
               SCOP domains d4dsoa_ A: automated matches                                                                                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeee.....hhhhhhhhhhhh..........eeeeeeeeee..eeeeeeeeee........hhhhhhhhh.eeeeeee..hhhhhhhhhhhhhhhhhhh......eeeeee.........hhhhhhhhhhhhh..eee.......hhhhhhhhhhhhhhhhh-hhhhhh...----.... Sec.struct. author
             SAPs(SNPs) (1) ----E------ADI-------E-----------L-M---------------------ITRH---------H---------------------------------------------N----------------------------TE-------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----N------AD--------R-----------Q-------------------------SR-------------------------------------------------------N----------------------------T--------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -----------CD--------------------R--------------------------R------------------------------------------------------------------------------------T--------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) -----------DD---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
             SAPs(SNPs) (5) -----------DR---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (5)
             SAPs(SNPs) (6) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (6)
             SAPs(SNPs) (7) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (7)
             SAPs(SNPs) (8) -----------D----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (8)
             SAPs(SNPs) (9) -----------R----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (9)
            SAPs(SNPs) (10) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (10)
            SAPs(SNPs) (11) -----------S----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (11)
            SAPs(SNPs) (12) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (12)
            SAPs(SNPs) (13) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (13)
            SAPs(SNPs) (14) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (14)
            SAPs(SNPs) (15) -----------V----------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (15)
                    PROSITE RAS  PDB: A:2-180 UniProt: 1-189                                                                                                                                                          PROSITE
           Transcript 1 (1) Exon 1.2a  PDB: A:1-37 UniProt: 1-37 Exon 1.3  PDB: A:38-97 UniProt: 38-97                       -----------------------------------------------------Exon 1.5b  PDB: A:151-180 (gaps)    Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------Exon 1.4  PDB: A:97-150 UniProt: 97-150               ----------------------------------- Transcript 1 (2)
                 4dso A   1 STEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHK-EKMSKDGKK----KKKK 180
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160      |169      |  - |   
                                                                                                                                                                                                167 |     176  177   
                                                                                                                                                                                                  168

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: P-loop containing nucleoside triphosphate hydrolases (2083)

Superfamily: P-loop containing nucleoside triphosphate hydrolases (2083)

Family: G proteins (693)

Protein domain: automated matches (173)

Human (Homo sapiens) [TaxId: 9606] (112)

d4dsoa_

(no "CATH Domain" information available for 4DSO)

(no "Pfam Domain" information available for 4DSO)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (RASK_HUMAN | P01116)

molecular function
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0019002	GMP binding	Interacting selectively and non-covalently with GMP, guanosine monophosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0030275	LRR domain binding	Interacting selectively and non-covalently with a LRR domain (leucine rich repeats) of a protein.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0038128	ERBB2 signaling pathway	A series of molecular signals initiated by binding of a ligand to a member of the ERBB family of receptors on the surface of a cell, where the signal is transmitted by ERBB2. The pathway ends with regulation of a downstream cellular process, e.g. transcription. ERBB2 receptors are themselves unable to bind to ligands, but act as a signal-amplifying tyrosine kinase within a heterodimeric pair.
	GO:0038095	Fc-epsilon receptor signaling pathway	A series of molecular signals initiated by the binding of the Fc portion of immunoglobulin E (IgE) to an Fc-epsilon receptor on the surface of a signal-receiving cell, and ending with regulation of a downstream cellular process, e.g. transcription. The Fc portion of an immunoglobulin is its C-terminal constant region.
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0007265	Ras protein signal transduction	A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
	GO:0030036	actin cytoskeleton organization	A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of cytoskeletal structures comprising actin filaments and their associated proteins.
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0038002	endocrine signaling	The transfer of information from one cell to another, where an endocrine hormone is transported from the signal-producing cell to the receiving cell via the circulatory system (via blood, lymph or cerebrospinal fluid). The signaling cell and the receiving cell are often distant to each other.
	GO:0007173	epidermal growth factor receptor signaling pathway	A series of molecular signals initiated by binding of a ligand to the tyrosine kinase receptor EGFR (ERBB1) on the surface of a cell. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0060441	epithelial tube branching involved in lung morphogenesis	The process in which a highly ordered sequence of patterning events generates the branched epithelial tubes of the lung, consisting of reiterated combinations of bud outgrowth, elongation, and dichotomous subdivision of terminal units.
	GO:0021897	forebrain astrocyte development	The process aimed at the progression of an astrocyte that resides in the forebrain, from initial commitment of the cell to its fate, to the fully functional differentiated cell. An astrocyte is the most abundant type of glial cell. Astrocytes provide support for neurons and regulate the environment in which they function.
	GO:0048873	homeostasis of number of cells within a tissue	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0045596	negative regulation of cell differentiation	Any process that stops, prevents, or reduces the frequency, rate or extent of cell differentiation.
	GO:0043524	negative regulation of neuron apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process in neurons.
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:0035022	positive regulation of Rac protein signal transduction	Any process that activates or increases the frequency, rate or extent of Rac protein signal transduction.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0051000	positive regulation of nitric-oxide synthase activity	Any process that activates or increases the activity of the enzyme nitric-oxide synthase.
	GO:0001934	positive regulation of protein phosphorylation	Any process that activates or increases the frequency, rate or extent of addition of phosphate groups to amino acids within a protein.
	GO:0048169	regulation of long-term neuronal synaptic plasticity	A process that modulates long-term neuronal synaptic plasticity, the ability of neuronal synapses to change long-term as circumstances require. Long-term neuronal synaptic plasticity generally involves increase or decrease in actual synapse numbers.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0032228	regulation of synaptic transmission, GABAergic	Any process that modulates the frequency, rate or extent of GABAergic synaptic transmission, the process of communication from a neuron to another neuron across a synapse using the neurotransmitter gamma-aminobutyric acid (GABA).
	GO:0051384	response to glucocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucocorticoid stimulus. Glucocorticoids are hormonal C21 corticosteroids synthesized from cholesterol with the ability to bind with the cortisol receptor and trigger similar effects. Glucocorticoids act primarily on carbohydrate and protein metabolism, and have anti-inflammatory effects.
	GO:0051385	response to mineralocorticoid	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a mineralocorticoid stimulus. Mineralocorticoids are hormonal C21 corticosteroids synthesized from cholesterol and characterized by their similarity to aldosterone. Mineralocorticoids act primarily on water and electrolyte balance.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007264	small GTPase mediated signal transduction	Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
	GO:0035176	social behavior	Behavior directed towards society, or taking place between members of the same species. Occurs predominantly, or only, in individuals that are part of a group.
	GO:0002223	stimulatory C-type lectin receptor signaling pathway	Any series of molecular signals generated as a consequence of binding to a C-type lectin receptor capable of cellular activation.
	GO:0051146	striated muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a striated muscle cell; striated muscle fibers are divided by transverse bands into striations, and cardiac and voluntary muscle are types of striated muscle.
	GO:0008542	visual learning	Any process in an organism in which a change in behavior of an individual occurs in response to repeated exposure to a visual cue.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its cytoplasmic surface, but not integrated into the hydrophobic region.
	GO:0005925	focal adhesion	Small region on the surface of a cell that anchors the cell to the extracellular matrix and that forms a point of termination of actin filaments.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0045121	membrane raft	Any of the small (10-200 nm), heterogeneous, highly dynamic, sterol- and sphingolipid-enriched membrane domains that compartmentalize cellular processes. Small rafts can sometimes be stabilized to form larger platforms through protein-protein and protein-lipid interactions.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BEN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		GSP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 4dso)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	4dso
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	RASK_HUMAN \| P01116
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.-.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	607785
		Disease Information	:	OMIM
	609942
		Disease Information	:	OMIM
	613659
		Disease Information	:	OMIM
	615278
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	RASK_HUMAN \| P01116
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (43, 43)

PROSITE Motifs (1, 1)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (49, 49)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File