3UVD - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN TRANSCRIPTION ACTIVATOR BRG1 (SMARCA4) IN COMPLEX WITH N-METHYL-2-PYRROLIDONE

Authors :   P. Filippakopoulos, I. Felletar, S. Picaud, T. Keates, J. Muniz, O. Gil F. Von Delft, C. H. Arrowsmith, A. M. Edwards, J. Weigelt, C. Bountra, Structural Genomics Consortium (Sgc)

Date :   29 Nov 11 (Deposition) - 18 Jan 12 (Release) - 11 Apr 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.85

Chains :   Asym./Biol. Unit : A

Keywords :   Bromodomain, Atp-Dependent Helicase Smarca4, Brg1-Associated Factor 190A, Baf190A, Mitotic Growth And Transcription Activator, Protein Brg-1, Protein Brahma Homolog 1, Snf2-Beta, Swi/Snf-Related Matrix- Associated Actin-Dependent Regulator Of Chromatin Subfamily A Member 4, Structural Genomics Consortium, Sgc, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. Filippakopoulos, S. Picaud, M. Mangos, T. Keates, J. P. Lambert, D. Barsyte-Lovejoy, I. Felletar, R. Volkmer, S. Muller, T. Pawson, A. C. Gingras, C. H. Arrowsmith, S. Knapp
Histone Recognition And Large-Scale Structural Analysis Of The Human Bromodomain Family.
Cell(Cambridge, Mass. ) V. 149 214 2012
PubMed-ID: 22464331 | Reference-DOI: 10.1016/J.CELL.2012.02.013

Molecule 1 - TRANSCRIPTION ACTIVATOR BRG1
	Chains	:	A
	EC Number	:	3.6.4.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PNIC28-BSA4
	Expression System Strain	:	BL21(DE3)-R3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 1448-1569
	Gene	:	BRG1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	BRG1-ASSOCIATED FACTOR PROTEIN BRG-1

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 1)

No.	Name	Count	Type	Full Name
1	MB3	1	Ligand/Ion	1-METHYLPYRROLIDIN-2-ONE

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:58 , VAL A:1484 , PHE A:1485 , PHE A:1539 , ASN A:1540	BINDING SITE FOR RESIDUE MB3 A 1

(no "SS Bond" information available for 3UVD)

(no "Cis Peptide Bond" information available for 3UVD)

(no "SAP(SNP)/Variant" information available for 3UVD)

Asymmetric/Biological Unit (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BROMODOMAIN_2	PS50014	Bromodomain profile.	SMCA4_HUMAN	1477-1547	1	A:1477-1547
2	BROMODOMAIN_1	PS00633	Bromodomain signature.	SMCA4_HUMAN	1482-1539	1	A:1482-1539

Asymmetric/Biological Unit (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000344626	1	ENSE00001132251	chr19:11071598-11071850	253	SMCA4_HUMAN	-	0	0	-	-
1.3a	ENST00000344626	3a	ENSE00000874191	chr19:11094797-11095049	253	SMCA4_HUMAN	1-74	74	0	-	-
1.4	ENST00000344626	4	ENSE00000874194	chr19:11095949-11096081	133	SMCA4_HUMAN	75-119	45	0	-	-
1.5	ENST00000344626	5	ENSE00000874195	chr19:11096865-11097269	405	SMCA4_HUMAN	119-254	136	0	-	-
1.6	ENST00000344626	6	ENSE00000874198	chr19:11097581-11097679	99	SMCA4_HUMAN	254-287	34	0	-	-
1.7	ENST00000344626	7	ENSE00000874199	chr19:11098342-11098600	259	SMCA4_HUMAN	287-373	87	0	-	-
1.8	ENST00000344626	8	ENSE00000874200	chr19:11099993-11100119	127	SMCA4_HUMAN	373-415	43	0	-	-
1.9	ENST00000344626	9	ENSE00001729313	chr19:11101826-11101999	174	SMCA4_HUMAN	416-473	58	0	-	-
1.10	ENST00000344626	10	ENSE00000874205	chr19:11105504-11105677	174	SMCA4_HUMAN	474-531	58	0	-	-
1.11	ENST00000344626	11	ENSE00001328899	chr19:11106889-11107056	168	SMCA4_HUMAN	532-587	56	0	-	-
1.12	ENST00000344626	12	ENSE00000874208	chr19:11107170-11107220	51	SMCA4_HUMAN	588-604	17	0	-	-
1.13	ENST00000344626	13	ENSE00000874209	chr19:11113705-11113835	131	SMCA4_HUMAN	605-648	44	0	-	-
1.14	ENST00000344626	14	ENSE00000874210	chr19:11114016-11114073	58	SMCA4_HUMAN	648-667	20	0	-	-
1.15	ENST00000344626	15	ENSE00000874211	chr19:11118578-11118699	122	SMCA4_HUMAN	668-708	41	0	-	-
1.16	ENST00000344626	16	ENSE00000874212	chr19:11121057-11121207	151	SMCA4_HUMAN	708-758	51	0	-	-
1.17	ENST00000344626	17	ENSE00000874213	chr19:11123625-11123788	164	SMCA4_HUMAN	759-813	55	0	-	-
1.18	ENST00000344626	18	ENSE00000874214	chr19:11129633-11129699	67	SMCA4_HUMAN	813-835	23	0	-	-
1.19	ENST00000344626	19	ENSE00001266976	chr19:11130267-11130377	111	SMCA4_HUMAN	836-872	37	0	-	-
1.20	ENST00000344626	20	ENSE00001669212	chr19:11132401-11132643	243	SMCA4_HUMAN	873-953	81	0	-	-
1.21	ENST00000344626	21	ENSE00000954162	chr19:11134194-11134307	114	SMCA4_HUMAN	954-991	38	0	-	-
1.22	ENST00000344626	22	ENSE00000954163	chr19:11135007-11135114	108	SMCA4_HUMAN	992-1027	36	0	-	-
1.23	ENST00000344626	23	ENSE00001621775	chr19:11136098-11136184	87	SMCA4_HUMAN	1028-1056	29	0	-	-
1.24	ENST00000344626	24	ENSE00000954165	chr19:11136976-11137022	47	SMCA4_HUMAN	1057-1072	16	0	-	-
1.25	ENST00000344626	25	ENSE00000954166	chr19:11138460-11138626	167	SMCA4_HUMAN	1072-1128	57	0	-	-
1.26	ENST00000344626	26	ENSE00000954167	chr19:11141406-11141569	164	SMCA4_HUMAN	1128-1182	55	0	-	-
1.27	ENST00000344626	27	ENSE00001671853	chr19:11143966-11144193	228	SMCA4_HUMAN	1183-1258	76	0	-	-
1.28	ENST00000344626	28	ENSE00000954169	chr19:11144443-11144541	99	SMCA4_HUMAN	1259-1291	33	0	-	-
1.29	ENST00000344626	29	ENSE00000954170	chr19:11144799-11144876	78	SMCA4_HUMAN	1292-1317	26	0	-	-
1.30	ENST00000344626	30	ENSE00000954171	chr19:11145590-11145808	219	SMCA4_HUMAN	1318-1390	73	0	-	-
1.33b	ENST00000344626	33b	ENSE00001413377	chr19:11151983-11152236	254	SMCA4_HUMAN	1391-1475	85	1	A:1447-1475	29
1.34a	ENST00000344626	34a	ENSE00001360053	chr19:11168931-11169039	109	SMCA4_HUMAN	1475-1511	37	1	A:1475-1511	37
1.35	ENST00000344626	35	ENSE00000954175	chr19:11169464-11169565	102	SMCA4_HUMAN	1512-1545	34	1	A:1512-1545	34
1.36	ENST00000344626	36	ENSE00001360043	chr19:11170429-11170561	133	SMCA4_HUMAN	1546-1590	45	1	A:1546-1568	23
1.37	ENST00000344626	37	ENSE00000954177	chr19:11170721-11170863	143	SMCA4_HUMAN	1590-1637	48	0	-	-
1.38	ENST00000344626	38	ENSE00001360023	chr19:11172460-11172958	499	SMCA4_HUMAN	1638-1647	10	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:122
 aligned with SMCA4_HUMAN | P51532 from UniProtKB/Swiss-Prot  Length:1647

    Alignment length:122
                                  1456      1466      1476      1486      1496      1506      1516      1526      1536      1546      1556      1566  
         SMCA4_HUMAN   1447 PAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKED 1568
               SCOP domains d3uvda_ A: automated matches                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhhhh.......hhhhhhh.......hhhhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------BROMODOMAIN_2  PDB: A:1477-1547 UniProt: 1477-1547                     --------------------- PROSITE (1)
                PROSITE (2) -----------------------------------BROMODOMAIN_1  PDB: A:1482-1539 UniProt: 1482-1539        ----------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.33b  PDB: A:1447-1475 ------------------------------------Exon 1.35  PDB: A:1512-1545       Exon 1.36 [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ----------------------------Exon 1.34a  PDB: A:1475-1511         --------------------------------------------------------- Transcript 1 (2)
                3uvd A 1447 MAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSVRQKIEKED 1568
                                  1456      1466      1476      1486      1496      1506      1516      1526      1536      1546      1556      1566

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Bromodomain-like (339)

Superfamily: Bromodomain (203)

Family: automated matches (169)

Protein domain: automated matches (169)

Human (Homo sapiens) [TaxId: 9606] (162)

d3uvda_

(no "CATH Domain" information available for 3UVD)

(no "Pfam Domain" information available for 3UVD)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (SMCA4_HUMAN | P51532)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0070182	DNA polymerase binding	Interacting selectively and non-covalently with a DNA polymerase.
	GO:0008094	DNA-dependent ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction requires the presence of single- or double-stranded DNA, and it drives another reaction.
	GO:0001164	RNA polymerase I CORE element sequence-specific DNA binding	Interacting selectively and non-covalently with the regulatory region composed of the transcription start site and binding sites for transcription factors of the RNA polymerase I transcription machinery. This site is often referred to as the CORE element. In mammalian cells, the CORE element functions in conjunction with the Upstream Control Element (UCE), while in fungi, protozoa, and plants, the CORE element functions without a UCE.
	GO:0000978	RNA polymerase II core promoter proximal region sequence-specific DNA binding	Interacting selectively and non-covalently with a sequence of DNA that is in cis with and relatively close to a core promoter for RNA polymerase II.
	GO:0000980	RNA polymerase II distal enhancer sequence-specific DNA binding	Interacting selectively and non-covalently with a RNA polymerase II (Pol II) distal enhancer. In mammalian cells, enhancers are distal sequences that increase the utilization of some promoters, and can function in either orientation and in any location (upstream or downstream) relative to the core promoter.
	GO:0001105	RNA polymerase II transcription coactivator activity	Interacting selectively and non-covalently with an RNA polymerase II (RNAP II) regulatory transcription factor and also with the RNAP II basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind DNA, but rather mediate protein-protein interactions between activating transcription factors and the basal RNAP II transcription machinery.
	GO:0030957	Tat protein binding	Interacting selectively and non-covalently with Tat, a viral transactivating regulatory protein from the human immunodeficiency virus, or the equivalent protein from another virus.
	GO:0050681	androgen receptor binding	Interacting selectively and non-covalently with an androgen receptor.
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0004386	helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016817	hydrolase activity, acting on acid anhydrides	Catalysis of the hydrolysis of any acid anhydride.
	GO:0070577	lysine-acetylated histone binding	Interacting selectively and non-covalently with a histone in which a lysine residue has been modified by acetylation.
	GO:0031492	nucleosomal DNA binding	Interacting selectively and non-covalently with the DNA portion of a nucleosome.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0002039	p53 binding	Interacting selectively and non-covalently with one of the p53 family of proteins.
	GO:0047485	protein N-terminus binding	Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0032403	protein complex binding	Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0003714	transcription corepressor activity	Interacting selectively and non-covalently with a repressing transcription factor and also with the basal transcription machinery in order to stop, prevent, or reduce the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between repressive transcription factors and the basal transcription machinery.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
biological process
	GO:0043044	ATP-dependent chromatin remodeling	Dynamic structural changes to eukaryotic chromatin that require energy from the hydrolysis of ATP, ranging from local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation, mediated by ATP-dependent chromatin-remodelling factors.
	GO:1904837	beta-catenin-TCF complex assembly	The aggregation, arrangement and bonding together of a set of components to form a beta-catenin-TCF complex.
	GO:0006338	chromatin remodeling	Dynamic structural changes to eukaryotic chromatin occurring throughout the cell division cycle. These changes range from the local changes necessary for transcriptional regulation to global changes necessary for chromosome segregation.
	GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	Any cell cycle regulatory process that prevents the commitment of a cell from G1 to S phase of the mitotic cell cycle.
	GO:0060766	negative regulation of androgen receptor signaling pathway	Any process that decreases the rate, frequency, or extent of the androgen receptor signaling pathway.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0007070	negative regulation of transcription from RNA polymerase II promoter during mitotic cell cycle	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter that occurs during the mitotic cell cycle.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0003407	neural retina development	The progression of the neural retina over time from its initial formation to the mature structure. The neural retina is the part of the retina that contains neurons and photoreceptor cells.
	GO:0006337	nucleosome disassembly	The controlled breakdown of nucleosomes, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0043923	positive regulation by host of viral transcription	Any process in which a host organism activates or increases the frequency, rate or extent of viral transcription, the synthesis of either RNA on a template of DNA or DNA on a template of RNA.
	GO:0030177	positive regulation of Wnt signaling pathway	Any process that activates or increases the frequency, rate or extent of Wnt signal transduction.
	GO:1902661	positive regulation of glucose mediated signaling pathway	Any process that activates or increases the frequency, rate or extent of glucose mediated signaling pathway.
	GO:1902895	positive regulation of pri-miRNA transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of pri-miRNA transcription from RNA polymerase II promoter.
	GO:0051091	positive regulation of sequence-specific DNA binding transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:1901838	positive regulation of transcription of nuclear large rRNA transcript from RNA polymerase I promoter	Any process that activates or increases the frequency, rate or extent of transcription of nuclear large rRNA transcript from RNA polymerase I promoter.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007286	spermatid development	The process whose specific outcome is the progression of a spermatid over time, from its formation to the mature structure.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0016514	SWI/SNF complex	A SWI/SNF-type complex that contains nine or more proteins, including both conserved (core) and nonconserved components; the Swi2/Snf2 ATPase is one of the core components.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0071565	nBAF complex	A SWI/SNF-type complex that is found in post-mitotic neurons, and in human contains actin and proteins encoded by the ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, DPF1/BAF45B, DPF3/BAF45C, ACTL6B/BAF53B genes. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
	GO:0071564	npBAF complex	A SWI/SNF-type complex that is found in neural stem or progenitor cells, and in human contains actin and proteins encoded by the ARID1A/BAF250A or ARID1B/BAF250B, SMARCD1/BAF60A, SMARCD3/BAF60C, SMARCA2/BRM/BAF190B, SMARCA4/BRG1/BAF190A, SMARCB1/BAF47, SMARCC1/BAF155, SMARCE1/BAF57, SMARCC2/BAF170, PHF10/BAF45A, ACTL6A/BAF53A genes. The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells.
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005730	nucleolus	A small, dense body one or more of which are present in the nucleus of eukaryotic cells. It is rich in RNA and protein, is not bounded by a limiting membrane, and is not seen during mitosis. Its prime function is the transcription of the nucleolar DNA into 45S ribosomal-precursor RNA, the processing of this RNA into 5.8S, 18S, and 28S components of ribosomal RNA, and the association of these components with 5S RNA and proteins synthesized outside the nucleolus. This association results in the formation of ribonucleoprotein precursors; these pass into the cytoplasm and mature into the 40S and 60S subunits of the ribosome.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MB3	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3uvd)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3uvd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SMCA4_HUMAN \| P51532
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.4.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SMCA4_HUMAN \| P51532
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SMCA4_HUMAN \| P51532	:	2grc 2h60 5dkd 5ea1

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 2)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (59, 59)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File