3UGR - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   AKR1C3 COMPLEX WITH INDOMETHACIN AT PH 6.8

Authors :   J. U. Flanagan, Y. Yosaatmadja, R. M. Teague, M. Chai, C. J. Squire

Date :   02 Nov 11 (Deposition) - 15 Aug 12 (Release) - 05 Nov 14 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.65

Chains :   Asym./Biol. Unit : A

Keywords :   Tim Barrel, Oxidoreductase, Multiple Small Moelcules, Hormones, Prostaglandins, Nsaids (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. U. Flanagan, Y. Yosaatmadja, R. M. Teague, M. Z. Chai, A. P. Turnbull C. J. Squire
Crystal Structures Of Three Classes Of Non-Steroidal Anti-Inflammatory Drugs In Complex With Aldo-Keto Reductase 1C3.
Plos One V. 7 43965 2012
PubMed-ID: 22937138 | Reference-DOI: 10.1371/JOURNAL.PONE.0043965

Molecule 1 - ALDO-KETO REDUCTASE FAMILY 1 MEMBER C3
	Chains	:	A
	EC Number	:	1.1.1.213, 1.1.1.112, 1.1.1.188, 1.1.1.63, 1.1.1.64, 1.3.1.20
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET22A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 5, 17-BETA-HSD 5, 3-ALPHA-HSD TYPE II, BRAIN, 3-ALPHA-HYDROXYSTEROID DEHYDROGENASE TYPE 2, 3-ALPHA-HSD TYPE 2, CHLORDECONE REDUCTASE HOMOLOG HAKRB, DIHYDRODIOL DEHYDROGENASE 3, DD-3, DD3, DIHYDRODIOL DEHYDROGENASE TYPE I, HA1753, INDANOL DEHYDROGENASE, PROSTAGLANDIN F SYNTHASE, PGFS, TESTOSTERONE 17-BETA-DEHYDROGENASE 5, TRANS-1,2-DIHYDROBENZENE- 1,2-DIOL DEHYDROGENASE, ALDO-KETO REDUCTASE 1C3

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (4, 5)

No.	Name	Count	Type	Full Name
1	DMS	1	Ligand/Ion	DIMETHYL SULFOXIDE
2	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
3	IMN	1	Ligand/Ion	INDOMETHACIN
4	NAP	1	Ligand/Ion	NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE

Asymmetric Unit (5, 5)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:22 , THR A:23 , TYR A:24 , ASP A:50 , TYR A:55 , HIS A:117 , SER A:166 , ASN A:167 , GLN A:190 , TYR A:216 , SER A:217 , ALA A:218 , LEU A:219 , GLY A:220 , SER A:221 , GLN A:222 , LEU A:236 , ALA A:253 , LEU A:268 , ALA A:269 , LYS A:270 , SER A:271 , TYR A:272 , ARG A:276 , GLN A:279 , ASN A:280 , HOH A:337 , HOH A:410 , HOH A:425 , HOH A:430 , HOH A:436 , HOH A:459 , IMN A:2001	BINDING SITE FOR RESIDUE NAP A 1001
2	AC2	SOFTWARE	TYR A:24 , LEU A:54 , TYR A:55 , TRP A:86 , HIS A:117 , SER A:118 , MET A:120 , ASN A:167 , GLU A:192 , TYR A:216 , SER A:217 , SER A:221 , GLN A:222 , TRP A:227 , PHE A:306 , PHE A:311 , TYR A:317 , TYR A:319 , HOH A:398 , HOH A:489 , NAP A:1001 , DMS A:2002	BINDING SITE FOR RESIDUE IMN A 2001
3	AC3	SOFTWARE	SER A:118 , MET A:120 , ASN A:167 , PHE A:306 , IMN A:2001	BINDING SITE FOR RESIDUE DMS A 2002
4	AC4	SOFTWARE	PHE A:15 , GLU A:77 , ASP A:78 , ILE A:79 , PHE A:80 , ASP A:112 , HOH A:473	BINDING SITE FOR RESIDUE EDO A 2004
5	AC5	SOFTWARE	LEU A:182 , LYS A:183 , LYS A:185 , HOH A:466 , HOH A:484 , HOH A:498	BINDING SITE FOR RESIDUE EDO A 2005

(no "SS Bond" information available for 3UGR)

(no "Cis Peptide Bond" information available for 3UGR)

Asymmetric/Biological Unit (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_032767	R	66	Q	AK1C3_HUMAN	Polymorphism	35961894	A	R	66	Q
2	UniProt	VAR_061001	E	77	G	AK1C3_HUMAN	Polymorphism	41306308	A	E	77	G
3	UniProt	VAR_032768	R	170	C	AK1C3_HUMAN	Polymorphism	35575889	A	R	170	C
4	UniProt	VAR_013289	M	175	I	AK1C3_HUMAN	Polymorphism	1131132	A	M	175	I
5	UniProt	VAR_032769	P	180	S	AK1C3_HUMAN	Polymorphism	34186955	A	P	180	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOKETO_REDUCTASE_1	PS00798	Aldo/keto reductase family signature 1.	AK1C3_HUMAN	45-62	1	A:45-62
2	ALDOKETO_REDUCTASE_2	PS00062	Aldo/keto reductase family signature 2.	AK1C3_HUMAN	151-168	1	A:151-168
3	ALDOKETO_REDUCTASE_3	PS00063	Aldo/keto reductase family putative active site signature.	AK1C3_HUMAN	268-283	1	A:268-283

Asymmetric/Biological Unit (9, 9)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.5a	ENST00000380554	5a	ENSE00001896041	chr10:5135985-5136720	736	AK1C3_HUMAN	1-28	28	1	A:6-28	23
1.6	ENST00000380554	6	ENSE00001653638	chr10:5138602-5138769	168	AK1C3_HUMAN	29-84	56	1	A:29-84	56
1.7c	ENST00000380554	7c	ENSE00001655668	chr10:5139626-5139742	117	AK1C3_HUMAN	85-123	39	1	A:85-123	39
1.8	ENST00000380554	8	ENSE00000907705	chr10:5140994-5141071	78	AK1C3_HUMAN	124-149	26	1	A:124-149 (gaps)	26
1.9	ENST00000380554	9	ENSE00001741294	chr10:5141519-5141641	123	AK1C3_HUMAN	150-190	41	1	A:150-190	41
1.10	ENST00000380554	10	ENSE00001623936	chr10:5144293-5144402	110	AK1C3_HUMAN	191-227	37	1	A:191-227	37
1.11	ENST00000380554	11	ENSE00001750670	chr10:5144677-5144842	166	AK1C3_HUMAN	227-282	56	1	A:227-282	56
1.12	ENST00000380554	12	ENSE00000907699	chr10:5147787-5147869	83	AK1C3_HUMAN	283-310	28	1	A:283-310	28
1.13	ENST00000380554	13	ENSE00001386806	chr10:5149653-5149878	226	AK1C3_HUMAN	310-323	14	1	A:310-319	10

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:308
 aligned with AK1C3_HUMAN | P42330 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:314
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    
          AK1C3_HUMAN     6 QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319
               SCOP domains d3ugra_ A: Prostaglandin d2 11-ketoreductase (akr1c3)                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee.....eee.eeee.........hhhhhhhhhhhhhh..eee.hhhhhhhhhhhhhhhhhhhh...hhhhheeeeeehhhhhhhhhhhhhhhhhhhhhh...eeeeee........------............hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhh.........eeeee......hhhhhhhhhhh..eeeee.................hhhhhhhhhhhhhhhh.hhhhhhhhhhhhh..eeeee..hhhhhhhhhhhhhh..hhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------Q----------G--------------------------------------------------------------------------------------------C----I----S------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------ALDOKETO_REDUCTASE----------------------------------------------------------------------------------------ALDOKETO_REDUCTASE---------------------------------------------------------------------------------------------------ALDOKETO_REDUCTA------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.5a  PDB: A:6-28 Exon 1.6  PDB: A:29-84 UniProt: 29-84                   Exon 1.7c  PDB: A:85-123               Exon 1.8 UniProt: 124-149 Exon 1.9  PDB: A:150-190 UniProt: 150-190Exon 1.10  PDB: A:191-227            -------------------------------------------------------Exon 1.12  PDB: A:283-310   --------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:227-282 UniProt: 227-282              ---------------------------Exon 1.13  Transcript 1 (2)
                 3ugr A   6 QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP------TDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPY 319
                                    15        25        35        45        55        65        75        85        95       105       115        |-     | 135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    
                                                                                                                                                124    131

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: TIM beta/alpha-barrel (3956)

Superfamily: NAD(P)-linked oxidoreductase (286)

Family: Aldo-keto reductases (NADP) (251)

Protein domain: Prostaglandin d2 11-ketoreductase (akr1c3) (30)

Human (Homo sapiens) [TaxId: 9606] (30)

d3ugra_

(no "CATH Domain" information available for 3UGR)

(no "Pfam Domain" information available for 3UGR)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (AK1C3_HUMAN | P42330)

molecular function
	GO:0047020	15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity	Catalysis of the reaction: NADP+ + (5Z,13E)-(15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate = NADPH + H+ + (5Z,13E)-9-alpha-hydroxy-11,15-dioxoprosta-5,13-dienoate.
	GO:0052650	NADP-retinol dehydrogenase activity	Catalysis of the reaction: all-trans-retinol + NADP+ = all-trans-retinal + NADPH + H+.
	GO:0004032	alditol:NADP+ 1-oxidoreductase activity	Catalysis of the reaction: an alditol + NADP+ = an aldose + NADPH + H+.
	GO:0004033	aldo-keto reductase (NADP) activity	Catalysis of the reaction: an alcohol + NADP+ = an aldehyde or a ketone + NADPH + H+.
	GO:0047023	androsterone dehydrogenase activity	Catalysis of the reaction: NAD(P)+ + androsterone = NAD(P)H + H+ + 5-alpha-androstane-3,17-dione.
	GO:0047787	delta4-3-oxosteroid 5beta-reductase activity	Catalysis of the reactions: (1) 5beta-cholestan-3-one + NADP+ = cholest-4-en-3-one + NADPH + H+ and (2) 17,21-dihydroxy-5beta-pregnane-3,11,20-trione + NADP+ = cortisone + NADPH + H+.
	GO:0035410	dihydrotestosterone 17-beta-dehydrogenase activity	Catalysis of the reaction: 5alpha-dihydrotestosterone + NAD+ = 5alpha-androstane-3,17-dione + NADH.
	GO:0045550	geranylgeranyl reductase activity	Catalysis of the formation of phytyl group from the stepwise reduction of a geranylgeranyl group.
	GO:0047718	indanol dehydrogenase activity	Catalysis of the reaction: indan-1-ol + NAD(P)+ = indanone + NAD(P)H + H+.
	GO:0045703	ketoreductase activity	Catalysis of the reduction of a ketone group to form the corresponding alcohol.
	GO:0047086	ketosteroid monooxygenase activity	Catalysis of the reaction: O2 + NADPH + progesterone = H2O + NADP+ + testosterone acetate.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016655	oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a quinone or a similar acceptor molecule.
	GO:0018636	phenanthrene 9,10-monooxygenase activity	Catalysis of the reaction: phenanthrene + O2 + NADH + H+ = H2O + NAD+ + phenanthrene-9,10-oxide.
	GO:0036131	prostaglandin D2 11-ketoreductase activity	Catalysis of the reaction: prostaglandin D2 + H+ + NADPH -> 11-epi-prostaglandin F2alpha + NADP+.
	GO:0036130	prostaglandin H2 endoperoxidase reductase activity	Catalysis of the reaction: prostaglandin H2 + NADPH + H+ -> prostaglandin F2alpha + NADP+. This reaction is the reduction of prostaglandin H2 ((5Z,13E)-(15S)-9alpha,11alpha-Epidioxy-15-hydroxyprosta-5,13-dienoate) to prostaglandin F2alpha ((5Z,13E)-(15S)-9alpha,11alpha,15-Trihydroxyprosta-5,13-dienoate).
	GO:0047017	prostaglandin-F synthase activity	Catalysis of the reaction: NADP+ + (5Z,13E)-(15S)-9-alpha,11-alpha,15-trihydroxyprosta-5,13-dienoate = NADPH + H+ + (5Z,13E)-(15S)-9-alpha,15-dihydroxy-11-oxoprosta-5,13-dienoate.
	GO:0001758	retinal dehydrogenase activity	Catalysis of the reaction: retinal + NAD+ + H2O = retinoate + NADH. Acts on both 11-trans and 13-cis forms of retinal.
	GO:0004745	retinol dehydrogenase activity	Catalysis of the reaction: retinol + NAD+ = retinal + NADH + H+.
	GO:0047045	testosterone 17-beta-dehydrogenase (NADP+) activity	Catalysis of the reaction: NADP+ + testosterone = NADPH + H+ + androst-4-ene-3,17-dione.
	GO:0047035	testosterone dehydrogenase (NAD+) activity	Catalysis of the reaction: testosterone + NAD+ = androst-4-ene-3,17-dione + NADH.
	GO:0047115	trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity	Catalysis of the reaction: NADP+ + trans-1,2-dihydrobenzene-1,2-diol = NADPH + catechol.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0071276	cellular response to cadmium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
	GO:0071277	cellular response to calcium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0071384	cellular response to corticosteroid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a corticosteroid hormone stimulus. A corticosteroid is a steroid hormone that is produced in the adrenal cortex. Corticosteroids are involved in a wide range of physiologic systems such as stress response, immune response and regulation of inflammation, carbohydrate metabolism, protein catabolism, blood electrolyte levels, and behavior. They include glucocorticoids and mineralocorticoids.
	GO:0071395	cellular response to jasmonic acid stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a jasmonic acid stimulus.
	GO:0071799	cellular response to prostaglandin D stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin D stimulus.
	GO:0071379	cellular response to prostaglandin stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a prostagladin stimulus.
	GO:0034614	cellular response to reactive oxygen species	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a reactive oxygen species stimulus. Reactive oxygen species include singlet oxygen, superoxide, and oxygen free radicals.
	GO:0009267	cellular response to starvation	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
	GO:0019371	cyclooxygenase pathway	The chemical reactions and pathways by which prostaglandins are formed from arachidonic acid, and in which prostaglandin-endoperoxide synthase (cyclooxygenase) catalyzes the committed step in the conversion of arachidonic acid to the prostaglandin-endoperoxides PGG2 and PGH2.
	GO:0044597	daunorubicin metabolic process	The chemical reactions and pathways involving daunorubicin, a chemotherapeutic of the anthracycline family that is given as a treatment for some types of cancer.
	GO:0044598	doxorubicin metabolic process	The chemical reactions and pathways involving doxorubicin, an anthracycline antibiotic, used in cancer chemotherapy.
	GO:0016488	farnesol catabolic process	The chemical reactions and pathways resulting in the breakdown of the sesquiterpenoid alcohol farnesol, 3,7,11-trimethyl-2,6,10,dodecatrien-1-ol.
	GO:0030216	keratinocyte differentiation	The process in which a relatively unspecialized cell acquires specialized features of a keratinocyte.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0044259	multicellular organismal macromolecule metabolic process	The chemical reactions and pathways involving macromolecules, large molecules including proteins, nucleic acids and carbohydrates, in multicellular organisms occurring at the tissue, organ, or organismal level.
	GO:1900053	negative regulation of retinoic acid biosynthetic process	Any process that stops, prevents or reduces the frequency, rate or extent of retinoic acid biosynthetic process.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0010942	positive regulation of cell death	Any process that increases the rate or frequency of cell death. Cell death is the specific activation or halting of processes within a cell so that its vital functions markedly cease, rather than simply deteriorating gradually over time, which culminates in cell death.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:2000353	positive regulation of endothelial cell apoptotic process	Any process that activates or increases the frequency, rate or extent of endothelial cell apoptotic process.
	GO:0051897	positive regulation of protein kinase B signaling	Any process that activates or increases the frequency, rate or extent of protein kinase B signaling, a series of reactions mediated by the intracellular serine/threonine kinase protein kinase B.
	GO:2000379	positive regulation of reactive oxygen species metabolic process	Any process that activates or increases the frequency, rate or extent of reactive oxygen species metabolic process.
	GO:0042448	progesterone metabolic process	The chemical reactions and pathways involving progesterone, a steroid hormone produced in the ovary which prepares and maintains the uterus for pregnancy. Also found in plants.
	GO:0006693	prostaglandin metabolic process	The chemical reactions and pathways involving prostaglandins, any of a group of biologically active metabolites which contain a cyclopentane ring due to the formation of a bond between two carbons of a fatty acid. They have a wide range of biological activities.
	GO:0000060	protein import into nucleus, translocation	A protein transport process that contributes to protein import into the nucleus, and that results in the vectorial transfer of a cargo-carrier protein complex through the nuclear pore complex from the cytoplasmic side to the nucleoplasmic side of the nuclear envelope.
	GO:0048385	regulation of retinoic acid receptor signaling pathway	Any process that modulates the frequency, rate or extent of retinoic acid receptor signaling pathway activity.
	GO:2000224	regulation of testosterone biosynthetic process	Any process that modulates the frequency, rate or extent of testosterone biosynthetic process.
	GO:0070293	renal absorption	A renal system process in which water, ions, glucose and proteins are taken up from the collecting ducts, glomerulus and proximal and distal loops of the nephron. In non-mammalian species, absorption may occur in related structures (e.g. protein absorption is observed in nephrocytes in Drosophila, see PMID:23264686).
	GO:0007584	response to nutrient	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a nutrient stimulus.
	GO:0042574	retinal metabolic process	The chemical reactions and pathways involving retinal, a compound that plays an important role in the visual process in most vertebrates. In the retina, retinal combines with opsins to form visual pigments. Retinal is one of the forms of vitamin A.
	GO:0001523	retinoid metabolic process	The chemical reactions and pathways involving retinoids, any member of a class of isoprenoids that contain or are derived from four prenyl groups linked head-to-tail. Retinoids include retinol and retinal and structurally similar natural derivatives or synthetic compounds, but need not have vitamin A activity.
	GO:0042572	retinol metabolic process	The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
	GO:0008202	steroid metabolic process	The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
	GO:0061370	testosterone biosynthetic process	The chemical reactions and pathways resulting in the formation of testosterone, an androgen having 17beta-hydroxy and 3-oxo groups, together with unsaturation at C-4 C-5.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DMS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		IMN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3ugr)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3ugr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AK1C3_HUMAN \| P42330
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.1.112
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.1.1.188
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.1.1.213
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.1.1.63
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.1.1.64
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	1.3.1.20
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AK1C3_HUMAN \| P42330
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

1s2a	AKR1C3 COMPLEX WITH INDOMETHACIN AT PH 6.0
3ufy
3ug8	AKR1C3 COMPLEX WITH INDOMETHACIN AT PH 7.5

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 5)

Sites (5, 5)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 5)

PROSITE Motifs (3, 3)

Exons (9, 9)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (62, 62)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File