3UF2 - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:140
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:145
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174     
           CSF1_HUMAN    35 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 179
               SCOP domains d3uf2a_ A: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......-----...eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: A:3-2Exon 1.4a            Exon 1.5b  PDB: A:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: A:101-147 UniProt: 133-182      Transcript 1
                 3uf2 A   3 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD-----KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 147
                                    12        22        32        42        52        62        72        82        92 |     102       112       122       132       142     
                                                                                                                      94   100

Chain B from PDB  Type:PROTEIN  Length:139
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:141
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177 
           CSF1_HUMAN    38 YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 178
               SCOP domains d3uf2b_ B: automated matches                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...--......eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3         Exon 1.4a            Exon 1.5b  PDB: B:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: B:101-146 UniProt: 133-182     Transcript 1
                 3uf2 B   6 YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD--EHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 146
                                    15        25        35        45        55        65        75        85        |- |     105       115       125       135       145 
                                                                                                                   94 97

Chain C from PDB  Type:PROTEIN  Length:143
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:143
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176   
           CSF1_HUMAN    37 EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 179
               SCOP domains d3uf2c_ C: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3          Exon 1.4a            Exon 1.5b  PDB: C:44-100 UniProt: 76-132                 Exon 1.6c  PDB: C:101-147 UniProt: 133-182      Transcript 1
                 3uf2 C   5 EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 147
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144

Chain D from PDB  Type:PROTEIN  Length:136
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:141
                                    47        57        67        77        87        97       107       117       127       137       147       157       167       177 
           CSF1_HUMAN    38 YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 178
               SCOP domains d3uf2d_ D: automated matches                                                                                                                  SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......-----...eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3         Exon 1.4a            Exon 1.5b  PDB: D:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: D:101-146 UniProt: 133-182     Transcript 1
                 3uf2 D   6 YCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD-----KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 146
                                    15        25        35        45        55        65        75        85        |-    |  105       115       125       135       145 
                                                                                                                   94   100

Chain E from PDB  Type:PROTEIN  Length:143
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:146
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174      
           CSF1_HUMAN    35 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS 180
               SCOP domains d3uf2e_ E: automated matches                                                                                                                       SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.......---....eeeeeehhhhhhhhhhhhhhhhhhhhh...hhhhh.hhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: E:3-2Exon 1.4a            Exon 1.5b  PDB: E:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: E:101-148 UniProt: 133-182       Transcript 1
                 3uf2 E   3 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDY---DKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS 148
                                    12        22        32        42        52        62        72        82        92  |   |102       112       122       132       142      
                                                                                                                       95  99

Chain F from PDB  Type:PROTEIN  Length:138
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:143
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175   
           CSF1_HUMAN    36 SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 178
               SCOP domains d3uf2f_ F: automated matches                                                                                                                    SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...-----...eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3           Exon 1.4a            Exon 1.5b  PDB: F:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: F:101-146 UniProt: 133-182     Transcript 1
                 3uf2 F   4 SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD-----KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 146
                                    13        23        33        43        53        63        73        83        93|     |103       113       123       133       143   
                                                                                                                     94   100

Chain G from PDB  Type:PROTEIN  Length:144
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:144
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175    
           CSF1_HUMAN    36 SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 179
               SCOP domains d3uf2g_ G: automated matches                                                                                                                     SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...........eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.3           Exon 1.4a            Exon 1.5b  PDB: G:44-100 UniProt: 76-132                 Exon 1.6c  PDB: G:101-147 UniProt: 133-182      Transcript 1
                 3uf2 G   4 SEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 147
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143

Chain H from PDB  Type:PROTEIN  Length:138
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:142
                                    46        56        66        76        86        96       106       116       126       136       146       156       166       176  
           CSF1_HUMAN    37 EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 178
               SCOP domains d3uf2h_ H: automated matches                                                                                                                   SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh.hhhhhhhhhhhhhhh......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh.....----..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3          Exon 1.4a            Exon 1.5b  PDB: H:44-96 UniProt: 76-132 [INCOMPLETE]     Exon 1.6c  PDB: H:101-146 UniProt: 133-182     Transcript 1
                 3uf2 H   5 EYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYE----ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC 146
                                    14        24        34        44        54        64        74        84        94 |    |104       114       124       134       144  
                                                                                                                      96  101

Chain I from PDB  Type:PROTEIN  Length:140
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:145
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174     
           CSF1_HUMAN    35 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 179
               SCOP domains d3uf2i_ I: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhh.hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......-----...eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: I:3-2Exon 1.4a            Exon 1.5b  PDB: I:44-100 (gaps) UniProt: 76-132          Exon 1.6c  PDB: I:101-147 UniProt: 133-182      Transcript 1
                 3uf2 I   3 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD-----KACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 147
                                    12        22        32        42        52        62        72        82        92 |     102       112       122       132       142     
                                                                                                                      94   100

Chain J from PDB  Type:PROTEIN  Length:139
 aligned with CSF1_HUMAN | P09603 from UniProtKB/Swiss-Prot  Length:554

    Alignment length:145
                                    44        54        64        74        84        94       104       114       124       134       144       154       164       174     
           CSF1_HUMAN    35 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 179
               SCOP domains d3uf2j_ J: automated matches                                                                                                                      SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh...hhhhhhhhhhhhhh.......eeeeee......hhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh......------..eeeeeehhhhhhhhhhhhhhhhhhhhhhh.hhhhh.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3  PDB: J:3-2Exon 1.4a            Exon 1.5b  PDB: J:44-94 UniProt: 76-132 [INCOMPLETE]     Exon 1.6c  PDB: J:101-147 UniProt: 133-182      Transcript 1
                 3uf2 J   3 VSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKD------ACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECS 147
                                    12        22        32        42        52        62        72        82        92 |     102       112       122       132       142     
                                                                                                                      94    101

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H,I,J (CSF1_HUMAN | P09603)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0005157	macrophage colony-stimulating factor receptor binding	Interacting selectively and non-covalently with the macrophage colony-stimulating factor receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0060444	branching involved in mammary gland duct morphogenesis	The process in which the branching structure of the mammary gland duct is generated and organized. The mammary gland is a large compound sebaceous gland that in female mammals is modified to secrete milk.
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0003006	developmental process involved in reproduction	A developmental process in which a progressive change in the state of some part of an organism specifically contributes to its ability to form offspring.
	GO:0030097	hemopoiesis	The process whose specific outcome is the progression of the myeloid and lymphoid derived organ/tissue systems of the blood and other parts of the body over time, from formation to the mature structure. The site of hemopoiesis is variable during development, but occurs primarily in bone marrow or kidney in many adult vertebrates.
	GO:0048873	homeostasis of number of cells within a tissue	Any biological process involved in the maintenance of the steady-state number of cells within a population of cells in a tissue.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0038145	macrophage colony-stimulating factor signaling pathway	A series of molecular signals initiated by the binding of the cytokine macrophage colony-stimulating factor (M-CSF) to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0030225	macrophage differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of a macrophage.
	GO:0060763	mammary duct terminal end bud growth	The morphogenetic growth of the large, club-shaped terminal end of a mammary gland duct during prepubertal growth and during puberty.
	GO:0060611	mammary gland fat development	The progression of the mammary gland fat over time, from its formation to the mature structure. The mammary fat is an adipose structure in the gland that is invaded by the mammary ducts.
	GO:0042117	monocyte activation	The change in morphology and behavior of a monocyte resulting from exposure to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0042476	odontogenesis	The process whose specific outcome is the progression of a tooth or teeth over time, from formation to the mature structure(s). A tooth is any hard bony, calcareous, or chitinous organ found in the mouth or pharynx of an animal and used in procuring or masticating food.
	GO:0001503	ossification	The formation of bone or of a bony substance, or the conversion of fibrous tissue or of cartilage into bone or a bony substance.
	GO:0030316	osteoclast differentiation	The process in which a relatively unspecialized monocyte acquires the specialized features of an osteoclast. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue.
	GO:0002158	osteoclast proliferation	The multiplication or reproduction of osteoclasts, resulting in the expansion of an osteoclast cell population. An osteoclast is a specialized phagocytic cell associated with the absorption and removal of the mineralized matrix of bone tissue, which typically differentiates from monocytes.
	GO:0046579	positive regulation of Ras protein signal transduction	Any process that activates or increases the frequency, rate or extent of Ras protein signal transduction.
	GO:0030335	positive regulation of cell migration	Any process that activates or increases the frequency, rate or extent of cell migration.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:0001954	positive regulation of cell-matrix adhesion	Any process that activates or increases the rate or extent of cell adhesion to an extracellular matrix.
	GO:0032270	positive regulation of cellular protein metabolic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways involving a protein, occurring at the level of an individual cell.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0010759	positive regulation of macrophage chemotaxis	Any process that increases the rate, frequency or extent of macrophage chemotaxis. Macrophage chemotaxis is the movement of a macrophage in response to an external stimulus.
	GO:1902228	positive regulation of macrophage colony-stimulating factor signaling pathway	Any process that activates or increases the frequency, rate or extent of macrophage colony-stimulating factor signaling pathway.
	GO:0010744	positive regulation of macrophage derived foam cell differentiation	Any process that increases the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
	GO:0045651	positive regulation of macrophage differentiation	Any process that activates or increases the frequency, rate or extent of macrophage differentiation.
	GO:1904141	positive regulation of microglial cell migration	Any process that activates or increases the frequency, rate or extent of microglial cell migration.
	GO:0045657	positive regulation of monocyte differentiation	Any process that activates or increases the frequency, rate or extent of monocyte differentiation.
	GO:0032946	positive regulation of mononuclear cell proliferation	Any process that activates or increases the frequency, rate or extent of mononuclear cell proliferation.
	GO:0040018	positive regulation of multicellular organism growth	Any process that activates or increases the frequency, rate or extent of growth of an organism to reach its usual body size.
	GO:0042488	positive regulation of odontogenesis of dentin-containing tooth	Any process that activates or increases the frequency, rate or extent of the formation and development of teeth, the hard, bony appendages that are borne on the jaws, or on other bones in the walls of the mouth or pharynx of most vertebrates.
	GO:0045672	positive regulation of osteoclast differentiation	Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
	GO:0045860	positive regulation of protein kinase activity	Any process that activates or increases the frequency, rate or extent of protein kinase activity.
	GO:0010743	regulation of macrophage derived foam cell differentiation	Any process that modulates the rate, frequency or extent of macrophage derived foam cell differentiation. Macrophage derived foam cell differentiation is the process in which a macrophage acquires the specialized features of a foam cell. A foam cell is a type of cell containing lipids in small vacuoles and typically seen in atherosclerotic lesions, as well as other conditions.
	GO:0030278	regulation of ossification	Any process that modulates the frequency, rate or extent of bone formation.
	GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	A series of molecular signals initiated by the binding of an extracellular ligand to a receptor on the surface of the target cell where the receptor possesses tyrosine kinase activity, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:1990682	CSF1-CSF1R complex	A protein complex consisting of a macrophage colony-stimulating factor (CSF1, also called M-CSF) dimer bound to a dimerized receptor (CSF1R, also called FMS). Receptor dimerization requires the presence of the ligand.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (35, 35)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (4, 40)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 10)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (51, 51)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File