3SCG - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   FE(II)-HPPE WITH R-HPP

Authors :   C. L. Drennan

Date :   07 Jun 11 (Deposition) - 06 Jul 11 (Release) - 10 Aug 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A,B  (2x)
Biol. Unit 2: C  (4x)

Keywords :   Cupin-Fold, Hydroxypropylphosphonic Acid Epoxidase, Mononuclear Non- Heme Iron Enzyme, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. Yun, M. Dey, L. J. Higgins, F. Yan, H. W. Liu, C. L. Drennan
Structural Basis Of Regiospecificity Of A Mononuclear Iron Enzyme In Antibiotic Fosfomycin Biosynthesis.
J. Am. Chem. Soc. V. 133 11262 2011
PubMed-ID: 21682308 | Reference-DOI: 10.1021/JA2025728

Molecule 1 - EPOXIDASE
	Chains	:	A, B, C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PPL001
	Expression System Strain	:	B834(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	FOM4
	Organism Scientific	:	STREPTOMYCES WEDMORENSIS
	Organism Taxid	:	43759

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (2x)	:	A	B
Biological Unit 2 (4x)	:			C

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 6)

No.	Name	Count	Type	Full Name
1	FE2	3	Ligand/Ion	FE (II) ION
2	TB6	3	Ligand/Ion	[(2R)-2-HYDROXYPROPYL]PHOSPHONIC ACID

Biological Unit 1 (1, 4)

No.	Name	Count	Type	Full Name
1	FE2	-1	Ligand/Ion	FE (II) ION
2	TB6	4	Ligand/Ion	[(2R)-2-HYDROXYPROPYL]PHOSPHONIC ACID

Biological Unit 2 (2, 16)

No.	Name	Count	Type	Full Name
1	FE2	12	Ligand/Ion	FE (II) ION
2	TB6	4	Ligand/Ion	[(2R)-2-HYDROXYPROPYL]PHOSPHONIC ACID

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:97 , TYR A:105 , ASN A:135 , HIS A:138 , GLU A:142 , HIS A:180 , PHE A:182 , HOH A:205 , LYS B:23 , FE2 C:216	BINDING SITE FOR RESIDUE TB6 A 199
2	AC2	SOFTWARE	LYS A:23 , ARG B:97 , TYR B:105 , ASN B:135 , HIS B:138 , GLU B:142 , LEU B:144 , HIS B:180 , PHE B:182 , HOH B:207 , HOH B:212 , FE2 C:217	BINDING SITE FOR RESIDUE TB6 B 199
3	AC3	SOFTWARE	HIS A:138 , GLU A:142 , HIS A:180 , TB6 A:199 , HOH A:205	BINDING SITE FOR RESIDUE FE2 C 216
4	AC4	SOFTWARE	HIS B:138 , GLU B:142 , HIS B:180 , TB6 B:199 , HOH B:207	BINDING SITE FOR RESIDUE FE2 C 217
5	AC5	SOFTWARE	LYS C:23 , ARG C:97 , TYR C:103 , TYR C:105 , ASN C:135 , HIS C:138 , GLU C:142 , HIS C:180 , PHE C:182 , FE2 C:199 , HOH C:215	BINDING SITE FOR RESIDUE TB6 C 200
6	AC6	SOFTWARE	HIS C:138 , GLU C:142 , HIS C:180 , TB6 C:200 , HOH C:215	BINDING SITE FOR RESIDUE FE2 C 199

(no "SS Bond" information available for 3SCG)

(no "Cis Peptide Bond" information available for 3SCG)

(no "SAP(SNP)/Variant" information available for 3SCG)

Asymmetric Unit (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	HPPE_STRWE	15-70	3	A:15-70 B:15-70 C:15-70

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	HPPE_STRWE	15-70	4	A:15-70 B:15-70 -

Biological Unit 2 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HTH_CROC1	PS50943	Cro/C1-type HTH domain profile.	HPPE_STRWE	15-70	4	- - C:15-70

(no "Exon" information available for 3SCG)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:193
 aligned with HPPE_STRWE | Q56185 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:193
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195   
           HPPE_STRWE     6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
               SCOP domains d3scga1 A:6-76                                                         d3scga2 A:77-198 Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhh.......hhhhhhhhhhhh..hhhhhh..............hhhhh.eeeee....eeeeeee..........eeeeeee...hhhhh.........eeeeeee..eeeeeee..eeeeeee....eeee.....eeeee......eeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------HTH_CROC1  PDB: A:15-70 UniProt: 15-70                  -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3scg A   6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195

Chain B from PDB  Type:PROTEIN  Length:193
 aligned with HPPE_STRWE | Q56185 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:193
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195   
           HPPE_STRWE     6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
               SCOP domains d3scgb1 B:6-76                                                         d3scgb2 B:77-198 Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhh..............hhhhh.eeeee....eeeeeee..........eeeeeee...hhhhh........eeeeeeee..eeeee......eeeee....eeee.....eeeee......eeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------HTH_CROC1  PDB: B:15-70 UniProt: 15-70                  -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3scg B   6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195

Chain C from PDB  Type:PROTEIN  Length:193
 aligned with HPPE_STRWE | Q56185 from UniProtKB/Swiss-Prot  Length:198

    Alignment length:193
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195   
           HPPE_STRWE     6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
               SCOP domains d3scgc1 C:6-76                                                         d3scgc2 C:77-198 Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhh..hhhhhhhhhh.hhhhhhhhh.......hhhhhhhhhhhh...hhhhh..............hhhhh.eeeee....eeeeeee..........eeeeeee...hhhhh........eeeeeeee..eeeeee....eeeeee....eeee.....eeeee......eeeeeeee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------HTH_CROC1  PDB: C:15-70 UniProt: 15-70                  -------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3scg C   6 TASTGFAELLKDRREQVKMDHAALASLLGETPETVAAWENGEGGELTLTQLGRIAHVLGTSIGALTPPAGNDLDDGVIIQMPDERPILKGVRDNVDYYVYNCLVRTKRAPSLVPLVVDVLTDNPDDAKFNSGHAGNEFLFVLEGEIHMKWGDKENPKEALLPTGASMFVEEHVPHAFTAAKGTGSAKLIAVNF 198
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 3SCG)

(no "Pfam Domain" information available for 3SCG)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (HPPE_STRWE | Q56185)

molecular function
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0051213	dioxygenase activity	Catalysis of an oxidation-reduction (redox) reaction in which both atoms of oxygen from one molecule of O2 are incorporated into the (reduced) product(s) of the reaction. The two atoms of oxygen may be distributed between two different products.
	GO:0008198	ferrous iron binding	Interacting selectively and non-covalently with ferrous iron, Fe(II).
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016717	oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced to two molecules of water.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
biological process
	GO:0017000	antibiotic biosynthetic process	The chemical reactions and pathways resulting in the formation of an antibiotic, a substance produced by or derived from certain fungi, bacteria, and other organisms, that can destroy or inhibit the growth of other microorganisms.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:1901766	phosphinothricin biosynthetic process	The chemical reactions and pathways resulting in the formation of phosphinothricin.
	GO:0051289	protein homotetramerization	The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FE2	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		TB6	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3scg)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3scg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HPPE_STRWE \| Q56185
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HPPE_STRWE \| Q56185
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	HPPE_STRWE \| Q56185	:	1zz6 1zz7 1zz8 1zz9 1zzb 1zzc 2bnm 2bnn 2bno 3scf 3sch 4j1w 4j1x

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 3)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File