|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3S92) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3S92) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3S92) |
PROSITE Motifs (2, 2)
Asymmetric/Biological Unit (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (3, 3)
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:110 aligned with BRD3_HUMAN | Q15059 from UniProtKB/Swiss-Prot Length:726 Alignment length:110 316 326 336 346 356 366 376 386 396 406 416 BRD3_HUMAN 307 KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP 416 SCOP domains d3s92a_ A: automated matches SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------Bromodomain-3s92A01 A:315-403 ------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------------------BROMODOMAIN_2 PDB: A:326-398 UniProt: 326-398 ------------------ PROSITE (1) PROSITE (2) ------------------------BROMODOMAIN_1 PDB: A:331-390 UniProt: 331-390 -------------------------- PROSITE (2) Transcript 1 Exon 1.9a PDB: A:307-362 UniProt: 239-362 [INCOMPLETE] Exon 1.10 PDB: A:363-405 UniProt: 363-405 Exon 1.11a Transcript 1 3s92 A 307 KLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMP 416 316 326 336 346 356 366 376 386 396 406 416
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3S92) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (7, 7)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (BRD3_HUMAN | Q15059)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|