2YW5 - JenaLib

NMR Structure - model 1

NMR Structure - all models

collapse

expand

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Description

Title :   SOLUTION STRUCTURE OF THE BROMODOMAIN FROM HUMAN BROMODOMAIN CONTAINING PROTEIN 3

Authors :   M. Furue, S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama, Riken Structural Genomics/Proteomics Initiative (Rsgi)

Date :   19 Apr 07 (Deposition) - 22 Apr 08 (Release) - 24 Feb 09 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (20x)

Keywords :   Bromodomain, Structural Genomics, Nppsfa, National Project On Protein Structural And Functional Analyses, Riken Structural Genomics/Proteomics Initiative, Rsgi, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Furue, S. Suzuki, Y. Muto, M. Inoue, T. Kigawa, T. Terada, M. Shirouzu, S. Yokoyama
Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3
To Be Published
PubMed: search
(for further references see the PDB file header)

Compounds

Molecule 1 - BROMODOMAIN-CONTAINING PROTEIN 3
	Chains	:	A
	Engineered	:	YES
	Expression System Plasmid	:	P060731-10
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 25-155, BROMODOMAIN
	Gene	:	BRD3, KIAA0043, RING3L
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	CELL-FREE PROTEIN SYNTHESIS
	Synonym	:	RING3-LIKE PROTEIN

Structural Features

Chains, Units


NMR Structure (20x)	:

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2YW5)

Sites (0, 0)

(no "Site" information available for 2YW5)

SS Bonds (0, 0)

(no "SS Bond" information available for 2YW5)

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 2YW5)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

NMR Structure (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_041913	T	36	N	BRD3_HUMAN	Unclassified	---	A	T	36	N

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (2, 2)

NMR Structure (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	BROMODOMAIN_2	PS50014	Bromodomain profile.	BRD3_HUMAN	51-123 326-398	1	A:51-123 -
2	BROMODOMAIN_1	PS00633	Bromodomain signature.	BRD3_HUMAN	56-115 331-390	1	A:56-115 -

Exons (3, 3)

NMR Structure (3, 3)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2a	ENST00000303407	2a	ENSE00001798041	chr9:136933139-136933067	73	BRD3_HUMAN	-	0	0	-	-
1.5b	ENST00000303407	5b	ENSE00001677558	chr9:136918712-136918387	326	BRD3_HUMAN	1-71	71	1	A:18-71 (gaps)	61
1.6b	ENST00000303407	6b	ENSE00001647906	chr9:136917565-136917428	138	BRD3_HUMAN	72-117	46	1	A:72-117	46
1.7	ENST00000303407	7	ENSE00001616318	chr9:136916831-136916684	148	BRD3_HUMAN	118-167	50	1	A:118-155	38
1.8a	ENST00000303407	8a	ENSE00001628171	chr9:136915710-136915496	215	BRD3_HUMAN	167-238	72	0	-	-
1.9a	ENST00000303407	9a	ENSE00001723584	chr9:136913576-136913205	372	BRD3_HUMAN	239-362	124	0	-	-
1.10	ENST00000303407	10	ENSE00001739092	chr9:136910543-136910415	129	BRD3_HUMAN	363-405	43	0	-	-
1.11a	ENST00000303407	11a	ENSE00001633127	chr9:136907073-136906882	192	BRD3_HUMAN	406-469	64	0	-	-
1.12	ENST00000303407	12	ENSE00001129684	chr9:136905391-136905156	236	BRD3_HUMAN	470-548	79	0	-	-
1.13c	ENST00000303407	13c	ENSE00001129681	chr9:136901446-136901154	293	BRD3_HUMAN	548-646	99	0	-	-
1.14	ENST00000303407	14	ENSE00001129674	chr9:136899951-136899823	129	BRD3_HUMAN	646-689	44	0	-	-
1.15b	ENST00000303407	15b	ENSE00001129727	chr9:136898827-136897963	865	BRD3_HUMAN	689-726	38	0	-	-

Sequences/Alignments

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:138
 aligned with BRD3_HUMAN | Q15059 from UniProtKB/Swiss-Prot  Length:726

    Alignment length:145
                                    20        30        40        50        60        70        80        90       100       110       120       130       140       150     
           BRD3_HUMAN    11 GIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK 155
               SCOP domains d2yw5a_        A: automated matches                                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------Bromodomain-2yw5A01 A:42-128                                                           --------------------------- Pfam domains
         Sec.struct. author .......-------...........hhhhhhhhhhhhhhhhhh..hhhhh...........hhhhhh....hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -------------------------N----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------------------------------BROMODOMAIN_2  PDB: A:51-123 UniProt: 51-123                             -------------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------------------BROMODOMAIN_1  PDB: A:56-115 UniProt: 56-115                ---------------------------------------- PROSITE (2)
               Transcript 1 Exon 1.5b  PDB: A:18-71 (gaps) UniProt: 1-71 [INCOMPLETE]    Exon 1.6b  PDB: A:72-117 UniProt: 72-117      Exon 1.7  PDB: A:118-155 [INCOMPLETE]  Transcript 1
                 2yw5 A  18 GSSGSSG-------EVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPPAPKGK 155
                                  |  -    |   30        40        50        60        70        80        90       100       110       120       130       140       150     
                                 24      25

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Bromodomain-like (339)

Superfamily: Bromodomain (203)

Family: automated matches (169)

Protein domain: automated matches (169)

Human (Homo sapiens) [TaxId: 9606] (162)

d2yw5a_

CATH Domains (0, 0)

(no "CATH Domain" information available for 2YW5)

Pfam Domains (1, 1)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Bromodomain] (56)

Family: Bromodomain (56)

Homo sapiens (Human) (44)

Bromodomain-2yw5A01

A:42-128

Gene Ontology (7, 7)

NMR Structure(hide GO term definitions)

Chain A (BRD3_HUMAN | Q15059)

molecular function
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0070577	lysine-acetylated histone binding	Interacting selectively and non-covalently with a histone in which a lysine residue has been modified by acetylation.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2yw5)

	Sites
(no "Sites" information available for 2yw5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2yw5)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2yw5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	BRD3_HUMAN \| Q15059
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	BRD3_HUMAN \| Q15059
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
	BRD3_HUMAN \| Q15059	:	2e7n 2nxb 2oo1 3s91 3s92 5a7c 5hfr 5hjc

Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2YW5)