3RBQ - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Biological Unit 7 (Jmol Viewer)

Biological Unit 8 (Jmol Viewer)

Biological Unit 9 (Jmol Viewer)

Biological Unit 10 (Jmol Viewer)

Biological Unit 11 (Jmol Viewer)

Biological Unit 12 (Jmol Viewer)

Title :   CO-CRYSTAL STRUCTURE OF HUMAN UNC119 (RETINA GENE 4) AND AN N-TERMINAL TRANSDUCIN-ALPHA MIMICKING PEPTIDE

Authors :   R. Constantine, F. G. Whitby, C. P. Hill, W. Baehr

Date :   29 Mar 11 (Deposition) - 08 Jun 11 (Release) - 20 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1: A,G  (1x)
Biol. Unit 2: B,H  (1x)
Biol. Unit 3: C,I  (1x)
Biol. Unit 4: D,J  (1x)
Biol. Unit 5: E,K  (1x)
Biol. Unit 6: F,L  (1x)
Biol. Unit 7: G  (1x)
Biol. Unit 8: H  (1x)
Biol. Unit 9: I  (1x)
Biol. Unit 10: J  (1x)
Biol. Unit 11: K  (1x)
Biol. Unit 12: L  (1x)

Keywords :   Unc(Uncoordinated)119 Homolog C. Elegans, G Protein Trafficking, Acyl Binnding Protein, Light-Induced Translocation, Unc119 Deletion, Protein Transport-Lipid Binding Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Zhang, R. Constantine, S. Vorobiev, Y. Chen, J. Seetharaman, Y. J. Huang, R. Xiao, G. T. Montelione, C. D. Gerstner, M. W. Davis, G. Inana, F. G. Whitby, E. M. Jorgensen, C. P. Hill, L. Tong, W. Baehr
Unc119 Is Required For G Protein Trafficking In Sensory Neurons.
Nat. Neurosci. V. 14 874 2011
PubMed-ID: 21642972 | Reference-DOI: 10.1038/NN.2835

Molecule 1 - PROTEIN UNC-119 HOMOLOG A
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	UNP RESIDUES 56-240
	Gene	:	UNC119, RG4
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	RETINAL PROTEIN 4, HRG4

Molecule 2 - GUANINE NUCLEOTIDE-BINDING PROTEIN G(T) SUBUNIT ALPHA-1
	Chains	:	G, H, I, J, K, L
	Engineered	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	SYNTHESIZED PEPTIDE
	Synonym	:	TRANSDUCIN ALPHA-1 CHAIN
	Synthetic	:	YES

		1	2	3	4	5	6	7	8	9	10	11	12
Asymmetric Unit	:	A	B	C	D	E	F	G	H	I	J	K	L
Biological Unit 1 (1x)	:	A						G
Biological Unit 2 (1x)	:		B						H
Biological Unit 3 (1x)	:			C						I
Biological Unit 4 (1x)	:				D						J
Biological Unit 5 (1x)	:					E						K
Biological Unit 6 (1x)	:						F						L
Biological Unit 7 (1x)	:							G
Biological Unit 8 (1x)	:								H
Biological Unit 9 (1x)	:									I
Biological Unit 10 (1x)	:										J
Biological Unit 11 (1x)	:											K
Biological Unit 12 (1x)	:												L

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	DAO	6	Mod. Amino Acid	LAURIC ACID

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 5 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 6 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 7 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 8 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 9 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 10 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 11 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Biological Unit 12 (1, 1)

No.	Name	Count	Type	Full Name
1	DAO	1	Mod. Amino Acid	LAURIC ACID

Asymmetric Unit (12, 12)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	PHE A:91 , TYR A:131 , GLU A:163 , HIS A:165 , PHE A:175 , TYR A:194 , PHE A:196 , TYR A:234 , GLY G:501 , ALA G:502 , GLY G:503	BINDING SITE FOR RESIDUE DAO G 500
02	AC2	SOFTWARE	VAL B:129 , TYR B:131 , GLU B:163 , HIS B:165 , PHE B:175 , TYR B:194 , PHE B:196 , TYR B:234 , GLY H:501 , ALA H:502 , GLY H:503	BINDING SITE FOR RESIDUE DAO H 500
03	AC3	SOFTWARE	TYR C:131 , GLU C:163 , PHE C:196 , TYR C:234 , GLY I:501 , ALA I:502 , GLY I:503	BINDING SITE FOR RESIDUE DAO I 500
04	AC4	SOFTWARE	TYR D:131 , GLU D:163 , TYR D:194 , TYR D:234 , GLY J:501 , ALA J:502 , GLY J:503	BINDING SITE FOR RESIDUE DAO J 500
05	AC5	SOFTWARE	TYR E:131 , GLU E:163 , TYR E:194 , PHE E:196 , TYR E:234 , GLY K:501 , ALA K:502 , GLY K:503	BINDING SITE FOR RESIDUE DAO K 500
06	AC6	SOFTWARE	PHE F:91 , TYR F:131 , GLU F:163 , PRO F:197 , TYR F:234 , GLY L:501 , ALA L:502 , GLY L:503	BINDING SITE FOR RESIDUE DAO L 500
07	AC7	SOFTWARE	ASP A:87 , PHE A:88 , PHE A:91 , ILE A:105 , LYS A:106 , LYS A:107 , GLY A:126 , ARG A:127 , TYR A:131 , GLU A:163 , SER A:218 , TYR A:220 , ASN A:230 , HOH A:294 , HOH A:784 , DAO G:500 , HOH G:776	BINDING SITE FOR CHAIN G OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1
08	AC8	SOFTWARE	PHE B:88 , PHE B:91 , ILE B:105 , LYS B:107 , GLY B:126 , ARG B:127 , PHE B:128 , VAL B:129 , TYR B:131 , GLU B:163 , SER B:218 , TYR B:220 , ASN B:230 , HOH B:318 , HOH H:281 , DAO H:500	BINDING SITE FOR CHAIN H OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1
09	AC9	SOFTWARE	PHE C:91 , ARG C:127 , PHE C:128 , TYR C:131 , GLU C:163 , SER C:218 , TYR C:220 , ASN C:230 , HOH C:276 , DAO I:500	BINDING SITE FOR CHAIN I OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1
10	BC1	SOFTWARE	PHE D:88 , PHE D:91 , GLY D:126 , ARG D:127 , PHE D:128 , TYR D:131 , GLU D:163 , SER D:218 , TYR D:220 , ASN D:230 , HOH D:252 , DAO J:500	BINDING SITE FOR CHAIN J OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1
11	BC2	SOFTWARE	PHE E:91 , VAL E:129 , TYR E:131 , GLU E:163 , SER E:218 , TYR E:220 , ASN E:230 , HOH E:660 , DAO K:500	BINDING SITE FOR CHAIN K OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1
12	BC3	SOFTWARE	SER B:200 , HOH B:265 , PHE F:88 , PHE F:91 , ILE F:105 , LYS F:106 , LYS F:107 , PRO F:108 , PRO F:123 , ALA F:125 , GLY F:126 , ARG F:127 , PHE F:128 , VAL F:129 , TYR F:131 , GLU F:163 , SER F:218 , TYR F:220 , MET F:228 , ASN F:230 , HOH L:25 , HOH L:97 , DAO L:500	BINDING SITE FOR CHAIN L OF GUANINE NUCLEOTIDE -BINDING PROTEIN G(T) SUBUNIT ALPHA-1

(no "SS Bond" information available for 3RBQ)

(no "Cis Peptide Bond" information available for 3RBQ)

Asymmetric Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009279	G	38	D	GNAT1_HUMAN	Disease (CSNBAD3)	104893740	K	G	503	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009279	G	38	D	GNAT1_HUMAN	Disease (CSNBAD3)	104893740	K	G	503	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 9 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 10 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 11 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_009279	G	38	D	GNAT1_HUMAN	Disease (CSNBAD3)	104893740	K	G	503	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 12 (0, 0)

						dbSNP	PDB
No.	Source	Variant ID	Variant	UniProt ID	Status	ID	Chain	Variant

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3RBQ)

(no "Exon" information available for 3RBQ)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh............hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee.hhhhhhh.eeeeeeeee.........eeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq A  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain B from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh...........hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee.hhhhhhh.eeeeeeeee.........eeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq B  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain C from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhh...........hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee.hhhhhhh.eeeeeeeee........eeeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq C  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain D from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh............hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee.hhhhhhh.eeeeeeeee........eeeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq D  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain E from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh............hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee.hhhhhhh.eeeeeeeee........eeeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq E  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain F from PDB  Type:PROTEIN  Length:165
 aligned with U119A_HUMAN | Q13432 from UniProtKB/Swiss-Prot  Length:240

    Alignment length:179
                                    69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229         
          U119A_HUMAN    60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ------------------GMP_PDE_delta-3rbqF01 F:78-237                                                                                                                                  - Pfam domains (1)
           Pfam domains (2) ------------------GMP_PDE_delta-3rbqF02 F:78-237                                                                                                                                  - Pfam domains (2)
           Pfam domains (3) ------------------GMP_PDE_delta-3rbqF03 F:78-237                                                                                                                                  - Pfam domains (3)
           Pfam domains (4) ------------------GMP_PDE_delta-3rbqF04 F:78-237                                                                                                                                  - Pfam domains (4)
           Pfam domains (5) ------------------GMP_PDE_delta-3rbqF05 F:78-237                                                                                                                                  - Pfam domains (5)
           Pfam domains (6) ------------------GMP_PDE_delta-3rbqF06 F:78-237                                                                                                                                  - Pfam domains (6)
         Sec.struct. author .hhhhhh...........hhhhh....eeeeeeeee.....eeeeee..--------------.....eeeee...hhhhh.eeeeeeeee........eeeeeeeee..eeeeeeeee........eeeeeeeee....hhhhhhhhhhh...eeeeeeeee..eeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3rbq F  60 IGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKP--------------PNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSG 238
                                    69        79        89        99        |-         -   |   129       139       149       159       169       179       189       199       209       219       229         
                                                                          108            123

Chain G from PDB  Type:PROTEIN  Length:8
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:8
          GNAT1_HUMAN     1 MGAGASAE   8
               SCOP domains -------- SCOP domains
               CATH domains -------- CATH domains
               Pfam domains -------- Pfam domains
         Sec.struct. author ........ Sec.struct. author
                 SAPs(SNPs) -------- SAPs(SNPs)
                    PROSITE -------- PROSITE
                 Transcript -------- Transcript
                 3rbq G 500 xGAGASAE 507
                            |       
                            |       
                          500-DAO

Chain H from PDB  Type:PROTEIN  Length:9
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:9
          GNAT1_HUMAN     1 MGAGASAEE   9
               SCOP domains --------- SCOP domains
               CATH domains --------- CATH domains
               Pfam domains --------- Pfam domains
         Sec.struct. author .hhhhhh.. Sec.struct. author
                 SAPs(SNPs) --------- SAPs(SNPs)
                    PROSITE --------- PROSITE
                 Transcript --------- Transcript
                 3rbq H 500 xGAGASAEE 508
                            |        
                          500-DAO

Chain I from PDB  Type:PROTEIN  Length:5
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:5
          GNAT1_HUMAN     1 MGAGA   5
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 3rbq I 500 xGAGA 504
                            |    
                          500-DAO

Chain J from PDB  Type:PROTEIN  Length:5
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:5
          GNAT1_HUMAN     1 MGAGA   5
               SCOP domains ----- SCOP domains
               CATH domains ----- CATH domains
               Pfam domains ----- Pfam domains
         Sec.struct. author ..... Sec.struct. author
                 SAPs(SNPs) ----- SAPs(SNPs)
                    PROSITE ----- PROSITE
                 Transcript ----- Transcript
                 3rbq J 500 xGAGA 504
                            |    
                            |    
                          500-DAO

Chain K from PDB  Type:PROTEIN  Length:4
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:4
          GNAT1_HUMAN    35 LGAG  38
               SCOP domains ---- SCOP domains
               CATH domains ---- CATH domains
               Pfam domains ---- Pfam domains
         Sec.struct. author .... Sec.struct. author
                 SAPs(SNPs) ---D SAPs(SNPs)
                    PROSITE ---- PROSITE
                 Transcript ---- Transcript
                 3rbq K 500 xGAG 503
                            |   
                            |   
                          500-DAO

Chain L from PDB  Type:PROTEIN  Length:10
 aligned with GNAT1_HUMAN | P11488 from UniProtKB/Swiss-Prot  Length:350

    Alignment length:10
                                    10
          GNAT1_HUMAN     1 MGAGASAEEK  10
               SCOP domains ---------- SCOP domains
               CATH domains ---------- CATH domains
           Pfam domains (1) --G-alpha- Pfam domains (1)
           Pfam domains (2) --G-alpha- Pfam domains (2)
           Pfam domains (3) --G-alpha- Pfam domains (3)
         Sec.struct. author .hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------- SAPs(SNPs)
                    PROSITE ---------- PROSITE
                 Transcript ---------- Transcript
                 3rbq L 500 xGAGASAEEK 509
                            |      509
                            |         
                          500-DAO

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3RBQ)

(no "CATH Domain" information available for 3RBQ)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: P-loop_NTPase (1112)

Family: G-alpha (24)

Homo sapiens (Human) (6)

1a	G-alpha-3rbqL01	L:502-509
1b	G-alpha-3rbqL02	L:502-509
1c	G-alpha-3rbqL03	L:502-509

Clan: no clan defined [family: GMP_PDE_delta] (3)

Family: GMP_PDE_delta (3)

Homo sapiens (Human) (3)

2a	GMP_PDE_delta-3rbqF01	F:78-237
2b	GMP_PDE_delta-3rbqF02	F:78-237
2c	GMP_PDE_delta-3rbqF03	F:78-237
2d	GMP_PDE_delta-3rbqF04	F:78-237
2e	GMP_PDE_delta-3rbqF05	F:78-237
2f	GMP_PDE_delta-3rbqF06	F:78-237

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (U119A_HUMAN | Q13432)

molecular function
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0007268	chemical synaptic transmission	The vesicular release of classical neurotransmitter molecules from a presynapse, across a chemical synapse, the subsequent activation of neurotransmitter receptors at the postsynapse of a target cell (neuron, muscle, or secretory cell) and the effects of this activation on the postsynaptic membrane potential and ionic composition of the postsynaptic cytosol. This process encompasses both spontaneous and evoked release of neurotransmitter and all parts of synaptic vesicle exocytosis. Evoked transmission starts with the arrival of an action potential at the presynapse.
	GO:0006897	endocytosis	A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
	GO:0042953	lipoprotein transport	The directed movement of any conjugated, water-soluble protein in which the nonprotein group consists of a lipid or lipids, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:2001287	negative regulation of caveolin-mediated endocytosis	Any process that stops, prevents or reduces the frequency, rate or extent of caveolin-mediated endocytosis.
	GO:1900186	negative regulation of clathrin-dependent endocytosis	Any process that stops, prevents or reduces the frequency, rate or extent of clathrin-mediated endocytosis.
	GO:0007602	phototransduction	The sequence of reactions within a cell required to convert absorbed photons into a molecular signal.
	GO:0061098	positive regulation of protein tyrosine kinase activity	Any process that increases the rate, frequency, or extent of protein tyrosine kinase activity.
	GO:0015031	protein transport	The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0050896	response to stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0045171	intercellular bridge	A direct connection between the cytoplasm of two cells that is formed following the completion of cleavage furrow ingression during cell division. They are usually present only briefly prior to completion of cytokinesis. However, in some cases, such as the bridges between germ cells during their development, they become stabilised.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005819	spindle	The array of microtubules and associated molecules that forms between opposite poles of a eukaryotic cell during mitosis or meiosis and serves to move the duplicated chromosomes apart.
	GO:0051233	spindle midzone	The area in the center of the spindle where the spindle microtubules from opposite poles overlap.
	GO:0000922	spindle pole	Either of the ends of a spindle, where spindle microtubules are organized; usually contains a microtubule organizing center and accessory molecules, spindle microtubules and astral microtubules.

Chain G,H,I,J,K,L (GNAT1_HUMAN | P11488)

molecular function
	GO:0031683	G-protein beta/gamma-subunit complex binding	Interacting selectively and non-covalently with a complex of G-protein beta/gamma subunits.
	GO:0001664	G-protein coupled receptor binding	Interacting selectively and non-covalently with a G-protein coupled receptor.
	GO:0019003	GDP binding	Interacting selectively and non-covalently with GDP, guanosine 5'-diphosphate.
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000035	acyl binding	Interacting selectively and non-covalently with an acyl group, any group formally derived by removal of the hydroxyl group from the acid function of a carboxylic acid.
	GO:0019001	guanyl nucleotide binding	Interacting selectively and non-covalently with guanyl nucleotides, any compound consisting of guanosine esterified with (ortho)phosphate.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
	GO:0004871	signal transducer activity	Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
	GO:0007186	G-protein coupled receptor signaling pathway	A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
	GO:0007188	adenylate cyclase-modulating G-protein coupled receptor signaling pathway	The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0071257	cellular response to electrical stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an electrical stimulus.
	GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	The series of events required for a bitter taste stimulus to be received and converted to a molecular signal.
	GO:0050908	detection of light stimulus involved in visual perception	The series of events involved in visual perception in which a light stimulus is received and converted into a molecular signal.
	GO:0042462	eye photoreceptor cell development	Development of a photoreceptor, a sensory cell in the eye that reacts to the presence of light. They usually contain a pigment that undergoes a chemical change when light is absorbed, thus stimulating a nerve.
	GO:0051344	negative regulation of cyclic-nucleotide phosphodiesterase activity	Any process that stops or reduces the rate of cyclic nucleotide phosphodiesterase activity, the catalysis of the reaction: nucleotide 3',5'-cyclic phosphate + H2O = nucleotide 5'-phosphate.
	GO:0007602	phototransduction	The sequence of reactions within a cell required to convert absorbed photons into a molecular signal.
	GO:0007603	phototransduction, visible light	The sequence of reactions within a cell required to convert absorbed photons from visible light into a molecular signal. A visible light stimulus is electromagnetic radiation that can be perceived visually by an organism; for organisms lacking a visual system, this can be defined as light with a wavelength within the range 380 to 780 nm.
	GO:0051343	positive regulation of cyclic-nucleotide phosphodiesterase activity	Any process that activates or increases the frequency, rate or extent of cyclic nucleotide phosphodiesterase activity, the catalysis of the reaction: nucleotide 3',5'-cyclic phosphate + H2O = nucleotide 5'-phosphate.
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0022400	regulation of rhodopsin mediated signaling pathway	Any process that modulates the frequency, rate or extent of rhodopsin-mediated signaling.
	GO:0009642	response to light intensity	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a light intensity stimulus.
	GO:0009416	response to light stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a light stimulus, electromagnetic radiation of wavelengths classified as infrared, visible or ultraviolet light.
	GO:0050896	response to stimulus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus. The process begins with detection of the stimulus and ends with a change in state or activity or the cell or organism.
	GO:0060041	retina development in camera-type eye	The process whose specific outcome is the progression of the retina over time, from its formation to the mature structure. The retina is the innermost layer or coating at the back of the eyeball, which is sensitive to light and in which the optic nerve terminates.
	GO:0016056	rhodopsin mediated signaling pathway	The series of molecular signals generated as a consequence of excitation of rhodopsin by a photon and the events that convert the absorbed photons into a cellular response.
	GO:0050917	sensory perception of umami taste	The series of events required to receive an umami taste stimulus, convert it to a molecular signal, and recognize and characterize the signal. Umami taste is the savory taste of meats and other foods that are rich in glutamates. This is a neurological process.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0007601	visual perception	The series of events required for an organism to receive a visual stimulus, convert it to a molecular signal, and recognize and characterize the signal. Visual stimuli are detected in the form of photons and are processed to form an image.
cellular component
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005834	heterotrimeric G-protein complex	Any of a family of heterotrimeric GTP-binding and hydrolyzing proteins; they belong to a superfamily of GTPases that includes monomeric proteins such as EF-Tu and RAS. Heterotrimeric G-proteins consist of three subunits; the alpha subunit contains the guanine nucleotide binding site and possesses GTPase activity; the beta and gamma subunits are tightly associated and function as a beta-gamma heterodimer; extrinsic plasma membrane proteins (cytoplasmic face) that function as a complex to transduce signals from G-protein coupled receptors to an effector protein.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043025	neuronal cell body	The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
	GO:0032391	photoreceptor connecting cilium	The portion of the photoreceptor cell cilium linking the photoreceptor inner and outer segments. It's considered to be equivalent to the ciliary transition zone.
	GO:0097381	photoreceptor disc membrane	Ovally-shaped membranous stack located inside the photoreceptor outer segment, and containing densely packed molecules of the photoreceptor protein rhodopsin that traverse the lipid bilayer. Disc membranes are apparently derived from the plasma membrane in the region of the cilium that connects the photoreceptor outer segment to the inner segment.
	GO:0001917	photoreceptor inner segment	The inner segment of a vertebrate photoreceptor containing mitochondria, ribosomes and membranes where opsin molecules are assembled and passed to be part of the outer segment discs.
	GO:0001750	photoreceptor outer segment	The outer segment of a vertebrate photoreceptor that contains discs of photoreceptive membranes.
	GO:0042622	photoreceptor outer segment membrane	The membrane surrounding the outer segment of a vertebrate photoreceptor.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		DAO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3rbq)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]
		Biological Unit 7	[ Jena3D ]
		Biological Unit 8	[ Jena3D ]
		Biological Unit 9	[ Jena3D ]
		Biological Unit 10	[ Jena3D ]
		Biological Unit 11	[ Jena3D ]
		Biological Unit 12	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format \| Biol. Unit 7 PNG format \| Biol. Unit 8 PNG format \| Biol. Unit 9 PNG format \| Biol. Unit 10 PNG format \| Biol. Unit 11 PNG format \| Biol. Unit 12 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3rbq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GNAT1_HUMAN \| P11488
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	U119A_HUMAN \| Q13432
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	610444
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GNAT1_HUMAN \| P11488
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	U119A_HUMAN \| Q13432
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	U119A_HUMAN \| Q13432	:	3gqq 4goj 4gok 5l7k

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (2, 9)

Gene Ontology (61, 66)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File