|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 21)
Asymmetric Unit (4, 21)
|
Sites (21, 21)
Asymmetric Unit (21, 21)
|
SS Bonds (12, 12)
Asymmetric Unit
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3R7C) |
PROSITE Motifs (1, 4)
Asymmetric Unit (1, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (2, 8)
Asymmetric Unit (2, 8)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:111 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:111 96 106 116 126 136 146 156 166 176 186 196 ALR_RAT 87 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d3r7ca_ A: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ERV_ALR PDB: A:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: A:14-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------Exon 1.3 PDB: A:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 3r7c A 14 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 23 33 43 53 63 73 83 93 103 113 123 Chain B from PDB Type:PROTEIN Length:111 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:111 96 106 116 126 136 146 156 166 176 186 196 ALR_RAT 87 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d3r7cb_ B: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ERV_ALR PDB: B:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: B:14-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------Exon 1.3 PDB: B:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 3r7c B 14 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 23 33 43 53 63 73 83 93 103 113 123 Chain C from PDB Type:PROTEIN Length:111 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:111 96 106 116 126 136 146 156 166 176 186 196 ALR_RAT 87 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d3r7cc_ C: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ERV_ALR PDB: C:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: C:14-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------Exon 1.3 PDB: C:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 3r7c C 14 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 23 33 43 53 63 73 83 93 103 113 123 Chain D from PDB Type:PROTEIN Length:111 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:111 96 106 116 126 136 146 156 166 176 186 196 ALR_RAT 87 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d3r7cd_ D: automated matches SCOP domains CATH domains --------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ERV_ALR PDB: D:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: D:14-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------Exon 1.3 PDB: D:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 3r7c D 14 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 23 33 43 53 63 73 83 93 103 113 123
|
||||||||||||||||||||
SCOP Domains (1, 4)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3R7C) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3R7C) |
Gene Ontology (22, 22)|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (ALR_RAT | Q63042)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|