![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 4)
|
Asymmetric Unit (8, 8)
|
Asymmetric Unit
|
(no "Cis Peptide Bond" information available for 1OQC) |
(no "SAP(SNP)/Variant" information available for 1OQC) |
Asymmetric Unit (1, 4)
|
Asymmetric Unit (2, 8)
|
Asymmetric UnitChain A from PDB Type:PROTEIN Length:112 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:112 95 105 115 125 135 145 155 165 175 185 195 ALR_RAT 86 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d1oqca_ A: Augmenter of liver regeneration SCOP domains CATH domains 1oqcA00 A:13-124 [code=1.20.120.310, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ERV_ALR PDB: A:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: A:13-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------Exon 1.3 PDB: A:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 1oqc A 13 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 22 32 42 52 62 72 82 92 102 112 122 Chain B from PDB Type:PROTEIN Length:111 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:111 96 106 116 126 136 146 156 166 176 186 196 ALR_RAT 87 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d1oqcb_ B: Augmenter of liver regeneration SCOP domains CATH domains 1oqcB00 B:14-124 [code=1.20.120.310, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ERV_ALR PDB: B:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: B:14-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) ----------------------------------------------------------Exon 1.3 PDB: B:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 1oqc B 14 DCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 23 33 43 53 63 73 83 93 103 113 123 Chain C from PDB Type:PROTEIN Length:112 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:112 95 105 115 125 135 145 155 165 175 185 195 ALR_RAT 86 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d1oqcc_ C: Augmenter of liver regeneration SCOP domains CATH domains 1oqcC00 C:13-124 [code=1.20.120.310, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ERV_ALR PDB: C:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: C:13-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------Exon 1.3 PDB: C:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 1oqc C 13 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 22 32 42 52 62 72 82 92 102 112 122 Chain D from PDB Type:PROTEIN Length:112 aligned with ALR_RAT | Q63042 from UniProtKB/Swiss-Prot Length:198 Alignment length:112 95 105 115 125 135 145 155 165 175 185 195 ALR_RAT 86 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 197 SCOP domains d1oqcd_ D: Augmenter of liver regeneration SCOP domains CATH domains 1oqcD00 D:13-124 [code=1.20.120.310, no name defined] CATH domains Pfam domains (1) -----------Evr1_Alr-1oqcD01 D:24-117 ------- Pfam domains (1) Pfam domains (2) -----------Evr1_Alr-1oqcD02 D:24-117 ------- Pfam domains (2) Pfam domains (3) -----------Evr1_Alr-1oqcD03 D:24-117 ------- Pfam domains (3) Pfam domains (4) -----------Evr1_Alr-1oqcD04 D:24-117 ------- Pfam domains (4) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ERV_ALR PDB: D:15-115 UniProt: 88-188 --------- PROSITE Transcript 1 (1) Exon 1.2 PDB: D:13-72 UniProt: 80-145 [INCOMPLETE] ---------------------------------------------------- Transcript 1 (1) Transcript 1 (2) -----------------------------------------------------------Exon 1.3 PDB: D:72-124 UniProt: 145-198 [INCOMPLETE] Transcript 1 (2) 1oqc D 13 EDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSC 124 22 32 42 52 62 72 82 92 102 112 122
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B,C,D (ALR_RAT | Q63042)
|
|
|
|
|
|
|