3QWR - JenaLib

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:295
 aligned with IL12B_HUMAN | P29460 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:304
                                    33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323    
          IL12B_HUMAN    24 WELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPC 327
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee..eee.......eeeee........eeeee...........eeeee.......eeeeeee.......eeee..eee..ee....ee...........eee......eeeeeeee.....eeeeeeeee.....eeeee...eeeee.-......eeeeeeeee............eeeeeeeee..eeeeeeeeehhhhhh.....eeeeeee......eeeeee.............eeeeeee.------...eeee...eeee....--.eeeeeee..........eee.. Sec.struct. author
                 SAPs(SNPs) ---------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------F----------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F3  PDB: A:211-253          ---------------------------------------------------- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN3  PDB: A:215-305 UniProt: 237-328                                                        PROSITE (2)
           Transcript 1 (1) 1.2    -------------------------------------------------------------------------------------------Exon 1.4  PDB: A:100-139                -----------------------------------------------------------------------Exon 1.6  PDB: A:211-263 (gaps) UniProt: 233-285     Exon 1.7  PDB: A:264-305 (gaps)            Transcript 1 (1)
           Transcript 1 (2) ------Exon 1.3  PDB: A:8-100 UniProt: 30-122                                                       --------------------------------------Exon 1.5  PDB: A:139-211 (gaps) UniProt: 161-233                         ---------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3qwr A   2 WELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAER-RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQ------KKDRVFTDKTSATVICRK--SISVRAQDRYYSSSWSEWASVPC 305
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151     | 161       171       181       191       201       211       221       231       241       251    |    - |     271        |- |     291       301    
                                                                                                                                                                                     157 |                                                                                              256    263              280  |                      
                                                                                                                                                                                       159                                                                                                                         283

Chain B from PDB  Type:PROTEIN  Length:141
 aligned with IL23A_HUMAN | Q9NPF7 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:162
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185  
          IL23A_HUMAN    26 SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATL 187
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh..........-----------...hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh...----------....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3qwr B   7 SSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLR-----------PHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEG----------LSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATL 168
                                    16        26        36 |       -   |    56        66        76        86        96       106       116   |     -    |  136       146       156       166  
                                                          38          50                                                                   120        131

Chain D from PDB  Type:PROTEIN  Length:91
                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeee....eeeee........eeeeeeee.......eeeeee....eeee........eeeeeeee............eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------- Transcript
                 3qwr D   3 DVPRDLEVVAATPTSLLISWEHDYPYRRYYRITYGETGGNSPVQEFTVPKDVDTATISGLKPGVDYTITVYAVTSSYKYDMQYSPISINYR  93
                                    12        22        32        42        52        62        72        82        92

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (IL12B_HUMAN | P29460)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0004896	cytokine receptor activity	Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
	GO:0005126	cytokine receptor binding	Interacting selectively and non-covalently with a cytokine receptor.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0042164	interleukin-12 alpha subunit binding	Interacting selectively and non-covalently with the alpha subunit of interleukin-12.
	GO:0005143	interleukin-12 receptor binding	Interacting selectively and non-covalently with the interleukin-12 receptor.
	GO:0045519	interleukin-23 receptor binding	Interacting selectively and non-covalently with the interleukin-23 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0042088	T-helper 1 type immune response	An immune response which is associated with resistance to intracellular bacteria, fungi, and protozoa, and pathological conditions such as arthritis, and which is typically orchestrated by the production of particular cytokines by T-helper 1 cells, most notably interferon-gamma, IL-2, and lymphotoxin.
	GO:0042093	T-helper cell differentiation	The process in which a relatively unspecialized thymocyte acquires specialized features of a T-helper cell.
	GO:0007050	cell cycle arrest	A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
	GO:0016477	cell migration	The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
	GO:0007166	cell surface receptor signaling pathway	A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
	GO:0071346	cellular response to interferon-gamma	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interferon-gamma stimulus. Interferon gamma is the only member of the type II interferon found so far.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0019221	cytokine-mediated signaling pathway	A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
	GO:0050829	defense response to Gram-negative bacterium	Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
	GO:0042832	defense response to protozoan	Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0042095	interferon-gamma biosynthetic process	The chemical reactions and pathways resulting in the formation of interferon-gamma. Interferon gamma is the only member of the type II interferon found so far.
	GO:0030101	natural killer cell activation	The change in morphology and behavior of a natural killer cell in response to a cytokine, chemokine, cellular ligand, or soluble factor.
	GO:0002323	natural killer cell activation involved in immune response	The change in morphology and behavior of a natural killer cell resulting from exposure a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
	GO:0044130	negative regulation of growth of symbiont in host	Any process in which the symbiont stops, prevents or reduces its increase in size or mass within the cells or tissues of the host organism. The host is defined as the larger of the organisms involved in the symbiotic interaction.
	GO:0002862	negative regulation of inflammatory response to antigenic stimulus	Any process that stops, prevents, or reduces the frequency, rate, or extent of an inflammatory response to an antigenic stimulus.
	GO:0032693	negative regulation of interleukin-10 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-10 production.
	GO:0032700	negative regulation of interleukin-17 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0048662	negative regulation of smooth muscle cell proliferation	Any process that stops, prevents or reduces the rate or extent of smooth muscle cell proliferation.
	GO:0042346	positive regulation of NF-kappaB import into nucleus	Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0051135	positive regulation of NK T cell activation	Any process that activates or increases the frequency, rate or extent of natural killer T cell activation.
	GO:0051142	positive regulation of NK T cell proliferation	Any process that activates or increases the frequency, rate or extent of natural killer T cell proliferation.
	GO:0001916	positive regulation of T cell mediated cytotoxicity	Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0002827	positive regulation of T-helper 1 type immune response	Any process that activates or increases the frequency, rate, or extent of a T-helper 1 type immune response.
	GO:2000330	positive regulation of T-helper 17 cell lineage commitment	Any process that activates or increases the frequency, rate or extent of T-helper 17 cell lineage commitment.
	GO:2000318	positive regulation of T-helper 17 type immune response	Any process that activates or increases the frequency, rate or extent of T-helper 17 type immune response.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0045785	positive regulation of cell adhesion	Any process that activates or increases the frequency, rate or extent of cell adhesion.
	GO:0002230	positive regulation of defense response to virus by host	Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	Any process that activates or increases the frequency, rate, or extent of granulocyte macrophage colony-stimulating factor production.
	GO:0050729	positive regulation of inflammatory response	Any process that activates or increases the frequency, rate or extent of the inflammatory response.
	GO:0045078	positive regulation of interferon-gamma biosynthetic process	Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interferon-gamma.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0032735	positive regulation of interleukin-12 production	Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
	GO:0032740	positive regulation of interleukin-17 production	Any process that activates or increases the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0050671	positive regulation of lymphocyte proliferation	Any process that activates or increases the rate or extent of lymphocyte proliferation.
	GO:0043382	positive regulation of memory T cell differentiation	Any process that activates or increases the frequency, rate or extent of memory T cell differentiation.
	GO:0032946	positive regulation of mononuclear cell proliferation	Any process that activates or increases the frequency, rate or extent of mononuclear cell proliferation.
	GO:0032816	positive regulation of natural killer cell activation	Any process that activates or increases the frequency, rate or extent of natural killer cell activation.
	GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	Any process that activates or increases the frequency, rate, or extent of natural killer cell mediated cytotoxicity directed against tumor cell target.
	GO:0032819	positive regulation of natural killer cell proliferation	Any process that activates or increases the frequency, rate or extent of natural killer cell proliferation.
	GO:0045672	positive regulation of osteoclast differentiation	Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0034105	positive regulation of tissue remodeling	Any process that activates or increases the frequency, rate, or extent of tissue remodeling.
	GO:0032760	positive regulation of tumor necrosis factor production	Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
	GO:0042035	regulation of cytokine biosynthetic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of cytokines.
	GO:0010224	response to UV-B	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0019233	sensory perception of pain	The series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal. Pain is medically defined as the physical sensation of discomfort or distress caused by injury or illness, so can hence be described as a harmful stimulus which signals current (or impending) tissue damage. Pain may come from extremes of temperature, mechanical damage, electricity or from noxious chemical substances. This is a neurological process.
	GO:0019953	sexual reproduction	A reproduction process that creates a new organism by combining the genetic material of two organisms. It occurs both in eukaryotes and prokaryotes: in multicellular eukaryotic organisms, an individual is created anew; in prokaryotes, the initial cell has additional or transformed genetic material. In a process called genetic recombination, genetic material (DNA) originating from two different individuals (parents) join up so that homologous sequences are aligned with each other, and this is followed by exchange of genetic information. After the new recombinant chromosome is formed, it is passed on to progeny.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0043514	interleukin-12 complex	A protein complex that is composed of an interleukin-12 alpha (p35, product of the IL12A gene) and an interleukin-12 beta subunit (p40, product of the IL12B gene) and is secreted into the extracellular space.
	GO:0070743	interleukin-23 complex	A protein complex that is composed of an interleukin-23 alpha (p19, product of the IL23A gene) and an interleukin-12 beta (p40, product of the IL12B gene) subunit and is secreted into the extracellular space.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain B (IL23A_HUMAN | Q9NPF7)

molecular function
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0045519	interleukin-23 receptor binding	Interacting selectively and non-covalently with the interleukin-23 receptor.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0042098	T cell proliferation	The expansion of a T cell population by cell division. Follows T cell activation.
	GO:0050829	defense response to Gram-negative bacterium	Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0002376	immune system process	Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
	GO:0006954	inflammatory response	The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
	GO:0045087	innate immune response	Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
	GO:0032693	negative regulation of interleukin-10 production	Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-10 production.
	GO:0042346	positive regulation of NF-kappaB import into nucleus	Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0051135	positive regulation of NK T cell activation	Any process that activates or increases the frequency, rate or extent of natural killer T cell activation.
	GO:0051142	positive regulation of NK T cell proliferation	Any process that activates or increases the frequency, rate or extent of natural killer T cell proliferation.
	GO:0001916	positive regulation of T cell mediated cytotoxicity	Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
	GO:0042102	positive regulation of T cell proliferation	Any process that activates or increases the rate or extent of T cell proliferation.
	GO:0002827	positive regulation of T-helper 1 type immune response	Any process that activates or increases the frequency, rate, or extent of a T-helper 1 type immune response.
	GO:2000330	positive regulation of T-helper 17 cell lineage commitment	Any process that activates or increases the frequency, rate or extent of T-helper 17 cell lineage commitment.
	GO:2000318	positive regulation of T-helper 17 type immune response	Any process that activates or increases the frequency, rate or extent of T-helper 17 type immune response.
	GO:0042104	positive regulation of activated T cell proliferation	Any process that activates or increases the rate or extent of activated T cell proliferation.
	GO:0002230	positive regulation of defense response to virus by host	Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
	GO:0032725	positive regulation of granulocyte macrophage colony-stimulating factor production	Any process that activates or increases the frequency, rate, or extent of granulocyte macrophage colony-stimulating factor production.
	GO:0050729	positive regulation of inflammatory response	Any process that activates or increases the frequency, rate or extent of the inflammatory response.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032733	positive regulation of interleukin-10 production	Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
	GO:0032735	positive regulation of interleukin-12 production	Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
	GO:0032740	positive regulation of interleukin-17 production	Any process that activates or increases the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
	GO:0043382	positive regulation of memory T cell differentiation	Any process that activates or increases the frequency, rate or extent of memory T cell differentiation.
	GO:0032816	positive regulation of natural killer cell activation	Any process that activates or increases the frequency, rate or extent of natural killer cell activation.
	GO:0032819	positive regulation of natural killer cell proliferation	Any process that activates or increases the frequency, rate or extent of natural killer cell proliferation.
	GO:0090023	positive regulation of neutrophil chemotaxis	Any process that increases the frequency, rate, or extent of neutrophil chemotaxis. Neutrophil chemotaxis is the directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0045672	positive regulation of osteoclast differentiation	Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
	GO:0034105	positive regulation of tissue remodeling	Any process that activates or increases the frequency, rate, or extent of tissue remodeling.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0032760	positive regulation of tumor necrosis factor production	Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
	GO:0048771	tissue remodeling	The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0070743	interleukin-23 complex	A protein complex that is composed of an interleukin-23 alpha (p19, product of the IL23A gene) and an interleukin-12 beta (p40, product of the IL12B gene) subunit and is secreted into the extracellular space.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 4)

Sites (4, 4)

SS Bonds (6, 6)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (2, 2)

Exons (6, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (77, 108)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File