Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF INTERLEUKIN-23
 
Authors :  P. J. Lupardus, K. C. Garcia
Date :  17 Jul 08  (Deposition) - 19 Aug 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.30
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Four-Helix Bundle Cytokine, Ig Domain, Cytokine, Glycoprotein, Immunoglobulin Domain, Secreted, Antiviral Defense, Immune Response, Inflammatory Response, Innate Immunity, Tissue Remodeling, Immune System, Immune System-Cytokine Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. J. Lupardus, K. C. Garcia
The Structure Of Interleukin-23 Reveals The Molecular Basis Of P40 Subunit Sharing With Interleukin-12.
J. Mol. Biol. V. 382 931 2008
PubMed-ID: 18680750  |  Reference-DOI: 10.1016/J.JMB.2008.07.051

(-) Compounds

Molecule 1 - INTERLEUKIN-12 SUBUNIT BETA
    Chains: A, B
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Plasmid: PACSG2
    Expression System Strain: HIFIVE
    Expression System Taxid: 7108
    Expression System Vector Type: PLASMID
    Gene: IL12B, NKSF2
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-12B, IL-12 SUBUNIT P40, CYTOTOXIC LYMPHOCYTE MATURATION FACTOR 40 KDA SUBUNIT, CLMF P40, NK CELL STIMULATORY FACTOR CHAIN 2, NKSF2
 
Molecule 2 - INTERLEUKIN-23 SUBUNIT ALPHA
    Chains: C, D
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Plasmid: PACSG2
    Expression System Strain: HIFIVE
    Expression System Taxid: 7108
    Expression System Vector Type: PLASMID
    Gene: IL23A, SGRF, UNQ2498/PRO5798
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: IL-23 SUBUNIT ALPHA, INTERLEUKIN-23 SUBUNIT P19, IL-23P19

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1NAG2Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1NAG1Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:2 , HIS A:83 , TYR A:198 , ASN A:200 , HOH A:368BINDING SITE FOR RESIDUE NAG A 313
2AC2SOFTWARETRP B:2 , GLU B:12 , HIS B:83 , TRP B:90 , ASN B:200BINDING SITE FOR RESIDUE NAG B 313

(-) SS Bonds  (12, 12)

Asymmetric Unit
No.Residues
1A:28 -A:68
2A:109 -A:120
3A:148 -A:171
4A:177 -C:54
5A:278 -A:305
6B:28 -B:68
7B:109 -B:120
8B:148 -B:171
9B:177 -D:54
10B:278 -B:305
11C:58 -C:70
12D:58 -D:70

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Thr A:242 -Pro A:243
2Thr B:242 -Pro B:243

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (2, 4)

Asymmetric Unit (2, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020001V33IIL12B_HUMANPolymorphism3213096A/BV11I
2UniProtVAR_049170V298FIL12B_HUMANPolymorphism3213119A/BV276F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020001V33IIL12B_HUMANPolymorphism3213096AV11I
2UniProtVAR_049170V298FIL12B_HUMANPolymorphism3213119AV276F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (2, 2)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_020001V33IIL12B_HUMANPolymorphism3213096BV11I
2UniProtVAR_049170V298FIL12B_HUMANPolymorphism3213119BV276F

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HEMATOPO_REC_L_F3PS01354 Long hematopoietin receptor, soluble alpha chains family signature.IL12B_HUMAN233-275
 
  2A:211-253
B:211-253
2FN3PS50853 Fibronectin type-III domain profile.IL12B_HUMAN237-328
 
  2A:215-306
B:215-305
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HEMATOPO_REC_L_F3PS01354 Long hematopoietin receptor, soluble alpha chains family signature.IL12B_HUMAN233-275
 
  1A:211-253
-
2FN3PS50853 Fibronectin type-III domain profile.IL12B_HUMAN237-328
 
  1A:215-306
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HEMATOPO_REC_L_F3PS01354 Long hematopoietin receptor, soluble alpha chains family signature.IL12B_HUMAN233-275
 
  1-
B:211-253
2FN3PS50853 Fibronectin type-III domain profile.IL12B_HUMAN237-328
 
  1-
B:215-305

(-) Exons   (6, 12)

Asymmetric Unit (6, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002312281ENSE00001230769chr5:158757895-158757440456IL12B_HUMAN-00--
1.2ENST000002312282ENSE00000797276chr5:158753790-15875370388IL12B_HUMAN1-30302A:0-8
B:-1-8
9
10
1.3ENST000002312283ENSE00000768666chr5:158750337-158750062276IL12B_HUMAN30-122932A:8-100
B:8-100
93
93
1.4ENST000002312284ENSE00000768664chr5:158749519-158749402118IL12B_HUMAN122-161402A:100-139
B:100-139
40
40
1.5ENST000002312285ENSE00000768662chr5:158747528-158747314215IL12B_HUMAN161-233732A:139-211 (gaps)
B:139-211 (gaps)
73
73
1.6ENST000002312286ENSE00000768660chr5:158745901-158745744158IL12B_HUMAN233-285532A:211-263
B:211-263 (gaps)
53
53
1.7ENST000002312287ENSE00001371782chr5:158743824-158743693132IL12B_HUMAN286-328432A:264-306
B:264-305
43
42
1.8ENST000002312288ENSE00000797274chr5:158743108-1587417911318IL12B_HUMAN-00--

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:300
 aligned with IL12B_HUMAN | P29460 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:307
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       
          IL12B_HUMAN    22 AIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS 328
               SCOP domains -d3duha1 A:1-87 The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain  d3duha2 A:88-211 The p40 domain of interleukin-12 (IL-12 beta chain),        domains 2 and 3                                d3duha3 A:212-306 The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3          SCOP domains
               CATH domains 3duhA01 A:0-84 Immunoglobulins                                                       ------------------3duhA02 A:103-210 Immunoglobulins                                                                           ---3duhA03 A:214-304 Immunoglobulins                                                          -- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee..eeeeeee.......eeeeee.........eeee.......ee..eeeeee.hhhhheeeeeee..eeeeeeeeeeeee......................eee......eeeeeeee.....eeeeeeeee.....eeeee...eeee.-------.eeeeeeeee............eeeeeeeee..eeeeeeeeehhhhhh.....eeeeeee.....eeeeeee.............eeeeeeeee......eeeeee...eeeee....eeeeeeeee..........eeee.. Sec.struct. author
                 SAPs(SNPs) -----------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------F------------------------------ SAPs(SNPs)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F3  PDB: A:211-253          ----------------------------------------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN3  PDB: A:215-306 UniProt: 237-328                                                         PROSITE (2)
           Transcript 1 (1) Exon 1.2 -------------------------------------------------------------------------------------------Exon 1.4  PDB: A:100-139                -----------------------------------------------------------------------Exon 1.6  PDB: A:211-263 UniProt: 233-285            Exon 1.7  PDB: A:264-306 UniProt: 286-328   Transcript 1 (1)
           Transcript 1 (2) --------Exon 1.3  PDB: A:8-100 UniProt: 30-122                                                       --------------------------------------Exon 1.5  PDB: A:139-211 (gaps) UniProt: 161-233                         ----------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3duh A   0 EIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAE-------EYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS 306
                                     9        19        29        39        49        59        69        79        89        99       109       119       129       139       149      |  -    |  169       179       189       199       209       219       229       239       249       259       269       279       289       299       
                                                                                                                                                                                      156     164                                                                                                                                              

Chain B from PDB  Type:PROTEIN  Length:294
 aligned with IL12B_HUMAN | P29460 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:307
                                    30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       
          IL12B_HUMAN    21 VAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPC 327
               SCOP domains --d3duhb1 B:1-87 The p40 domain of interleukin-12 (IL-12 beta chain), N-terminal domain  d3duhb2 B:88-211 The p40 domain of interleukin-12 (IL-12 beta chain),      domains 2 and 3                                  d3duhb3 B:212    -305 The p40 domain of interle    ukin-12 (IL-12 beta chain), domains 2 and 3 SCOP domains
               CATH domains 3duhB01 B:-1-84 Immunoglobulins                                                       ------------------3duhB02 B:103-210 Immunoglobulins                                                                           ---3duhB03 B:2    14-304 Immunoglobulins                                                      - CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee..eeeeeee.......eeeeee........eeee........ee..eeeeee.hhhhheeeeeee..eeeeeeeeeeeeee..ee.................eee......eeeeeeee.....eeeeeeeee.....eeeee...eeee.-----...eeeeeeeee............eeeeeeeee..eeeeeeeeehhhhhh.....eeeeee..----.eeeeee.............eeeeeeee..----..eeeee...eeee......eeeeeeee..........eeee. Sec.struct. author
                 SAPs(SNPs) ------------I------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------F----------------------------- SAPs(SNPs)
                PROSITE (1) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEMATOPO_REC_L_F3  PDB: B:211-253          ---------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------FN3  PDB: B:215-305 UniProt: 237-328                                                        PROSITE (2)
           Transcript 1 (1) Exon 1.2  -------------------------------------------------------------------------------------------Exon 1.4  PDB: B:100-139                -----------------------------------------------------------------------Exon 1.6  PDB: B:211-263 (gaps) UniProt: 233-285     Exon 1.7  PDB: B:264-305 UniProt: 286-328  Transcript 1 (1)
           Transcript 1 (2) ---------Exon 1.3  PDB: B:8-100 UniProt: 30-122                                                       --------------------------------------Exon 1.5  PDB: B:139-211 (gaps) UniProt: 161-233                         ---------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3duh B  -1 LEIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAE-----NKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPL----QVEVSWEYPDTWSTPHSYFSLTFCVQVQGK----KKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPC 305
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       | -   |   168       178       188       198       208       218     |   -|      238       248       258    |  268       278       288       298       
                                                                                                                                                                                       156   162                                                           224  229                          258  263                                          

Chain C from PDB  Type:PROTEIN  Length:137
 aligned with IL23A_HUMAN | Q9NPF7 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:170
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188
          IL23A_HUMAN    19 GRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLS 188
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhh...-----------------......hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......-----.hhhhhhhhhhhhhhhhh........-----------.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3duh C   0 LRAVPGGSSPAWTQCQQLSQKLCTLAWSAH-----------------NDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEP-----SPVGQLHASLLGLSQLLQPEGHHWET-----------WQRLLLRFKILRSLQAFVAVAARVFAHGAATLS 169
                                     9        19        29         -       |49        59        69        79        89    |    -|      109       119     |   -       139       149       159       169
                                                        29                47                                             94   100                      125         137                                

Chain D from PDB  Type:PROTEIN  Length:137
 aligned with IL23A_HUMAN | Q9NPF7 from UniProtKB/Swiss-Prot  Length:189

    Alignment length:174
                                                                                                                                                                                                    189   
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188|   
          IL23A_HUMAN    19 GRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP---   -
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........hhhhhhhhhhhhhhhhhh.------------------......hhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....-----....hhhhhhhhhhhhhhhhh.....--------------.....hhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3duh D   0 LRAVPGGSSPAWTQCQQLSQKLCTLAWSA------------------NDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFT-----LPDSPVGQLHASLLGLSQLLQPEGHH--------------WQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPHHH 173
                                     9        19        |-         -       |49        59        69        79        89 |     |99       109       119  |      -       139       149       159       169    
                                                       28                 47                                          91    97                      122            137                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 6)

Asymmetric Unit

(-) CATH Domains  (1, 6)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)
1a3duhB02B:103-210
1b3duhA02A:103-210
1c3duhB01B:-1-84
1d3duhA01A:0-84
1e3duhA03A:214-304
1f3duhB03B:214-304

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3DUH)

(-) Gene Ontology  (77, 108)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (IL12B_HUMAN | P29460)
molecular function
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0004896    cytokine receptor activity    Combining with a cytokine and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity.
    GO:0005126    cytokine receptor binding    Interacting selectively and non-covalently with a cytokine receptor.
    GO:0008083    growth factor activity    The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0042164    interleukin-12 alpha subunit binding    Interacting selectively and non-covalently with the alpha subunit of interleukin-12.
    GO:0005143    interleukin-12 receptor binding    Interacting selectively and non-covalently with the interleukin-12 receptor.
    GO:0045519    interleukin-23 receptor binding    Interacting selectively and non-covalently with the interleukin-23 receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
    GO:0042088    T-helper 1 type immune response    An immune response which is associated with resistance to intracellular bacteria, fungi, and protozoa, and pathological conditions such as arthritis, and which is typically orchestrated by the production of particular cytokines by T-helper 1 cells, most notably interferon-gamma, IL-2, and lymphotoxin.
    GO:0042093    T-helper cell differentiation    The process in which a relatively unspecialized thymocyte acquires specialized features of a T-helper cell.
    GO:0007050    cell cycle arrest    A regulatory process that halts progression through the cell cycle during one of the normal phases (G1, S, G2, M).
    GO:0016477    cell migration    The controlled self-propelled movement of a cell from one site to a destination guided by molecular cues. Cell migration is a central process in the development and maintenance of multicellular organisms.
    GO:0007166    cell surface receptor signaling pathway    A series of molecular signals initiated by activation of a receptor on the surface of a cell. The pathway begins with binding of an extracellular ligand to a cell surface receptor, or for receptors that signal in the absence of a ligand, by ligand-withdrawal or the activity of a constitutively active receptor. The pathway ends with regulation of a downstream cellular process, e.g. transcription.
    GO:0071346    cellular response to interferon-gamma    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interferon-gamma stimulus. Interferon gamma is the only member of the type II interferon found so far.
    GO:0071222    cellular response to lipopolysaccharide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0019221    cytokine-mediated signaling pathway    A series of molecular signals initiated by the binding of a cytokine to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0042832    defense response to protozoan    Reactions triggered in response to the presence of a protozoan that act to protect the cell or organism.
    GO:0051607    defense response to virus    Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
    GO:0042095    interferon-gamma biosynthetic process    The chemical reactions and pathways resulting in the formation of interferon-gamma. Interferon gamma is the only member of the type II interferon found so far.
    GO:0030101    natural killer cell activation    The change in morphology and behavior of a natural killer cell in response to a cytokine, chemokine, cellular ligand, or soluble factor.
    GO:0002323    natural killer cell activation involved in immune response    The change in morphology and behavior of a natural killer cell resulting from exposure a cytokine, chemokine, cellular ligand, or soluble factor, leading to the initiation or perpetuation of an immune response.
    GO:0044130    negative regulation of growth of symbiont in host    Any process in which the symbiont stops, prevents or reduces its increase in size or mass within the cells or tissues of the host organism. The host is defined as the larger of the organisms involved in the symbiotic interaction.
    GO:0002862    negative regulation of inflammatory response to antigenic stimulus    Any process that stops, prevents, or reduces the frequency, rate, or extent of an inflammatory response to an antigenic stimulus.
    GO:0032693    negative regulation of interleukin-10 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-10 production.
    GO:0032700    negative regulation of interleukin-17 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
    GO:0048662    negative regulation of smooth muscle cell proliferation    Any process that stops, prevents or reduces the rate or extent of smooth muscle cell proliferation.
    GO:0042346    positive regulation of NF-kappaB import into nucleus    Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0051135    positive regulation of NK T cell activation    Any process that activates or increases the frequency, rate or extent of natural killer T cell activation.
    GO:0051142    positive regulation of NK T cell proliferation    Any process that activates or increases the frequency, rate or extent of natural killer T cell proliferation.
    GO:0001916    positive regulation of T cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
    GO:0042102    positive regulation of T cell proliferation    Any process that activates or increases the rate or extent of T cell proliferation.
    GO:0002827    positive regulation of T-helper 1 type immune response    Any process that activates or increases the frequency, rate, or extent of a T-helper 1 type immune response.
    GO:2000330    positive regulation of T-helper 17 cell lineage commitment    Any process that activates or increases the frequency, rate or extent of T-helper 17 cell lineage commitment.
    GO:2000318    positive regulation of T-helper 17 type immune response    Any process that activates or increases the frequency, rate or extent of T-helper 17 type immune response.
    GO:0042104    positive regulation of activated T cell proliferation    Any process that activates or increases the rate or extent of activated T cell proliferation.
    GO:0045785    positive regulation of cell adhesion    Any process that activates or increases the frequency, rate or extent of cell adhesion.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0032725    positive regulation of granulocyte macrophage colony-stimulating factor production    Any process that activates or increases the frequency, rate, or extent of granulocyte macrophage colony-stimulating factor production.
    GO:0050729    positive regulation of inflammatory response    Any process that activates or increases the frequency, rate or extent of the inflammatory response.
    GO:0045078    positive regulation of interferon-gamma biosynthetic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of interferon-gamma.
    GO:0032729    positive regulation of interferon-gamma production    Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
    GO:0032733    positive regulation of interleukin-10 production    Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
    GO:0032735    positive regulation of interleukin-12 production    Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
    GO:0032740    positive regulation of interleukin-17 production    Any process that activates or increases the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
    GO:0050671    positive regulation of lymphocyte proliferation    Any process that activates or increases the rate or extent of lymphocyte proliferation.
    GO:0043382    positive regulation of memory T cell differentiation    Any process that activates or increases the frequency, rate or extent of memory T cell differentiation.
    GO:0032946    positive regulation of mononuclear cell proliferation    Any process that activates or increases the frequency, rate or extent of mononuclear cell proliferation.
    GO:0032816    positive regulation of natural killer cell activation    Any process that activates or increases the frequency, rate or extent of natural killer cell activation.
    GO:0002860    positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target    Any process that activates or increases the frequency, rate, or extent of natural killer cell mediated cytotoxicity directed against tumor cell target.
    GO:0032819    positive regulation of natural killer cell proliferation    Any process that activates or increases the frequency, rate or extent of natural killer cell proliferation.
    GO:0045672    positive regulation of osteoclast differentiation    Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
    GO:0034393    positive regulation of smooth muscle cell apoptotic process    Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
    GO:0034105    positive regulation of tissue remodeling    Any process that activates or increases the frequency, rate, or extent of tissue remodeling.
    GO:0032760    positive regulation of tumor necrosis factor production    Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
    GO:0042035    regulation of cytokine biosynthetic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of cytokines.
    GO:0010224    response to UV-B    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a UV-B radiation stimulus. UV-B radiation (UV-B light) spans the wavelengths 280 to 315 nm.
    GO:0010033    response to organic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
    GO:0019233    sensory perception of pain    The series of events required for an organism to receive a painful stimulus, convert it to a molecular signal, and recognize and characterize the signal. Pain is medically defined as the physical sensation of discomfort or distress caused by injury or illness, so can hence be described as a harmful stimulus which signals current (or impending) tissue damage. Pain may come from extremes of temperature, mechanical damage, electricity or from noxious chemical substances. This is a neurological process.
    GO:0019953    sexual reproduction    A reproduction process that creates a new organism by combining the genetic material of two organisms. It occurs both in eukaryotes and prokaryotes: in multicellular eukaryotic organisms, an individual is created anew; in prokaryotes, the initial cell has additional or transformed genetic material. In a process called genetic recombination, genetic material (DNA) originating from two different individuals (parents) join up so that homologous sequences are aligned with each other, and this is followed by exchange of genetic information. After the new recombinant chromosome is formed, it is passed on to progeny.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0043514    interleukin-12 complex    A protein complex that is composed of an interleukin-12 alpha (p35, product of the IL12A gene) and an interleukin-12 beta subunit (p40, product of the IL12B gene) and is secreted into the extracellular space.
    GO:0070743    interleukin-23 complex    A protein complex that is composed of an interleukin-23 alpha (p19, product of the IL23A gene) and an interleukin-12 beta (p40, product of the IL12B gene) subunit and is secreted into the extracellular space.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain C,D   (IL23A_HUMAN | Q9NPF7)
molecular function
    GO:0005125    cytokine activity    Functions to control the survival, growth, differentiation and effector function of tissues and cells.
    GO:0045519    interleukin-23 receptor binding    Interacting selectively and non-covalently with the interleukin-23 receptor.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0042098    T cell proliferation    The expansion of a T cell population by cell division. Follows T cell activation.
    GO:0050829    defense response to Gram-negative bacterium    Reactions triggered in response to the presence of a Gram-negative bacterium that act to protect the cell or organism.
    GO:0051607    defense response to virus    Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
    GO:0006955    immune response    Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
    GO:0002376    immune system process    Any process involved in the development or functioning of the immune system, an organismal system for calibrated responses to potential internal or invasive threats.
    GO:0006954    inflammatory response    The immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents. The process is characterized by local vasodilation, extravasation of plasma into intercellular spaces and accumulation of white blood cells and macrophages.
    GO:0045087    innate immune response    Innate immune responses are defense responses mediated by germline encoded components that directly recognize components of potential pathogens.
    GO:0032693    negative regulation of interleukin-10 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-10 production.
    GO:0042346    positive regulation of NF-kappaB import into nucleus    Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0051135    positive regulation of NK T cell activation    Any process that activates or increases the frequency, rate or extent of natural killer T cell activation.
    GO:0051142    positive regulation of NK T cell proliferation    Any process that activates or increases the frequency, rate or extent of natural killer T cell proliferation.
    GO:0001916    positive regulation of T cell mediated cytotoxicity    Any process that activates or increases the frequency, rate or extent of T cell mediated cytotoxicity.
    GO:0042102    positive regulation of T cell proliferation    Any process that activates or increases the rate or extent of T cell proliferation.
    GO:0002827    positive regulation of T-helper 1 type immune response    Any process that activates or increases the frequency, rate, or extent of a T-helper 1 type immune response.
    GO:2000330    positive regulation of T-helper 17 cell lineage commitment    Any process that activates or increases the frequency, rate or extent of T-helper 17 cell lineage commitment.
    GO:2000318    positive regulation of T-helper 17 type immune response    Any process that activates or increases the frequency, rate or extent of T-helper 17 type immune response.
    GO:0042104    positive regulation of activated T cell proliferation    Any process that activates or increases the rate or extent of activated T cell proliferation.
    GO:0002230    positive regulation of defense response to virus by host    Any host process that results in the promotion of antiviral immune response mechanisms, thereby limiting viral replication.
    GO:0032725    positive regulation of granulocyte macrophage colony-stimulating factor production    Any process that activates or increases the frequency, rate, or extent of granulocyte macrophage colony-stimulating factor production.
    GO:0050729    positive regulation of inflammatory response    Any process that activates or increases the frequency, rate or extent of the inflammatory response.
    GO:0032729    positive regulation of interferon-gamma production    Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
    GO:0032733    positive regulation of interleukin-10 production    Any process that activates or increases the frequency, rate, or extent of interleukin-10 production.
    GO:0032735    positive regulation of interleukin-12 production    Any process that activates or increases the frequency, rate, or extent of interleukin-12 production.
    GO:0032740    positive regulation of interleukin-17 production    Any process that activates or increases the frequency, rate, or extent of production of any member of the interleukin-17 family of cytokines.
    GO:0043382    positive regulation of memory T cell differentiation    Any process that activates or increases the frequency, rate or extent of memory T cell differentiation.
    GO:0032816    positive regulation of natural killer cell activation    Any process that activates or increases the frequency, rate or extent of natural killer cell activation.
    GO:0032819    positive regulation of natural killer cell proliferation    Any process that activates or increases the frequency, rate or extent of natural killer cell proliferation.
    GO:0090023    positive regulation of neutrophil chemotaxis    Any process that increases the frequency, rate, or extent of neutrophil chemotaxis. Neutrophil chemotaxis is the directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
    GO:0045672    positive regulation of osteoclast differentiation    Any process that activates or increases the frequency, rate or extent of osteoclast differentiation.
    GO:0034105    positive regulation of tissue remodeling    Any process that activates or increases the frequency, rate, or extent of tissue remodeling.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0032760    positive regulation of tumor necrosis factor production    Any process that activates or increases the frequency, rate, or extent of tumor necrosis factor production.
    GO:0048771    tissue remodeling    The reorganization or renovation of existing tissues. This process can either change the characteristics of a tissue such as in blood vessel remodeling, or result in the dynamic equilibrium of a tissue such as in bone remodeling.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0070743    interleukin-23 complex    A protein complex that is composed of an interleukin-23 alpha (p19, product of the IL23A gene) and an interleukin-12 beta (p40, product of the IL12B gene) subunit and is secreted into the extracellular space.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Thr A:242 - Pro A:243   [ RasMol ]  
    Thr B:242 - Pro B:243   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3duh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IL12B_HUMAN | P29460
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  IL23A_HUMAN | Q9NPF7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IL12B_HUMAN | P29460
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  IL23A_HUMAN | Q9NPF7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IL12B_HUMAN | P29460: 1f42 1f45 3d85 3d87 3hmx 3qwr 4grw 5mj3 5mj4
        IL23A_HUMAN | Q9NPF7: 3d85 3d87 3qwr 4grw 5mj3 5mj4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3DUH)