|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (0, 0)| (no "Site" information available for 3QPT) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3QPT) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3QPT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3QPT) |
PROSITE Motifs (1, 1)
Asymmetric Unit (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3QPT) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:132 aligned with SLYA_SALTY | P40676 from UniProtKB/Swiss-Prot Length:144 Alignment length:139 14 24 34 44 54 64 74 84 94 104 114 124 134 SLYA_SALTY 5 LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMELHSH 143 SCOP domains d3qpta_ A: Transcriptional regulator SlyA SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------MarR-3qptA01 A:29-88 ------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------HTH_MARR_1 PDB: A:62-96 ----------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3qpt A 5 LGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQT-------KRIKLTEKAEPLIAEmEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNImELHSH 143 14 24 34 44 54 64 74 | - | 94 104 114 124 134 | 80 88 103-MSE 138-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3QPT) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A (SLYA_SALTY | P40676)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|