|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 6)
Asymmetric Unit (1, 6)
|
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3DEU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3DEU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3DEU) |
PROSITE Motifs (2, 4)
Asymmetric Unit (2, 4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3DEU) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:132 aligned with SLYA_SALTY | P40676 from UniProtKB/Swiss-Prot Length:144 Alignment length:140 10 20 30 40 50 60 70 80 90 100 110 120 130 140 SLYA_SALTY 1 MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL 140 SCOP domains d3deua1 A:2-141 Transcriptional regulator SlyA SCOP domains CATH domains 3deuA00 A:2-141 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -HTH_MARR_2 PDB: A:3-136 UniProt: 2-135 ----- PROSITE (1) PROSITE (2) -------------------------------------------------------------HTH_MARR_1 PDB: A:63-97 -------------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3deu A 2 LESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQ--------KRIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL 141 11 21 31 41 51 61 71 |- |91 101 111 121 131 141 80 89 Chain B from PDB Type:PROTEIN Length:130 aligned with SLYA_SALTY | P40676 from UniProtKB/Swiss-Prot Length:144 Alignment length:140 10 20 30 40 50 60 70 80 90 100 110 120 130 140 SLYA_SALTY 1 MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISRQTCASDRRAKRIKLTEKADALIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL 140 SCOP domains d3deub_ B: Transcriptional regulator SlyA SCOP domains CATH domains 3deuB00 B:2-141 'winged helix' repressor DNA binding domain CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -HTH_MARR_2 PDB: B:3-136 UniProt: 2-135 ----- PROSITE (1) PROSITE (2) -------------------------------------------------------------HTH_MARR_1 PDB: B:63-97 -------------------------------------------- PROSITE (2) Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript 3deu B 2 LESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLDQLEDKGLISR----------RIKLTEKAEPLIAEMEEVIHKTRGEILAGISSEEIELLIKLIAKLEHNIMEL 141 11 21 31 41 51 61 71 | - 91 101 111 121 131 141 79 90
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3DEU) |
Gene Ontology (5, 5)|
Asymmetric Unit(hide GO term definitions) Chain A,B (SLYA_SALTY | P40676)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|