Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE YEAST HETEROTRIMERIC NUP82-NUP159-NUP116 NUCLEOPORIN COMPLEX
 
Authors :  E. W. Debler, A. Hoelz
Date :  20 Oct 10  (Deposition) - 26 Oct 11  (Release) - 02 Nov 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,I,J,K,L
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Biol. Unit 3:  G,H,I  (1x)
Biol. Unit 4:  J,K,L  (1x)
Keywords :  Beta-Propeller, Nucleoporin, Mrna Export, Mrnp Remodelling, Nucleocytoplasmic Transport, Protein Transport, Translocation, Transport, Autoproteolysis, Fusion Protein, Protooncogene, Oncoprotein, Protein Complex, Nucleus, Nuclear Envelope, Nuclear Pore Complex, Transport Protein, Transport Protein, Structural Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Yoshida, H. S. Seo, E. W. Debler, G. Blobel, A. Hoelz
Structural And Functional Analysis Of An Essential Nucleoporin Heterotrimer On The Cytoplasmic Face Of The Nuclear Pore Complex.
Proc. Natl. Acad. Sci. Usa V. 108 16571 2011
PubMed-ID: 21930948  |  Reference-DOI: 10.1073/PNAS.1112846108

(-) Compounds

Molecule 1 - NUCLEOPORIN NUP82
    Chains: A, D, G, J
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: N-TERMINAL DOMAIN (NTD), UNP RESIDUES 1-452
    Gene: NUP82, YJL061W, J1135, HRB187
    Mutation: YES
    Organism Common: YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: NUCLEAR PORE PROTEIN NUP82
 
Molecule 2 - NUCLEOPORIN NUP116/NSP116
    Chains: B, E, H, K
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: C-TERMINAL DOMAIN (CTD), UNP RESIDUES 967-1113
    Gene: NUP116, NSP116, YMR047C, YM9532.12C
    Organism Common: YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: NUCLEAR PORE PROTEIN NUP116/NSP116
 
Molecule 3 - NUCLEOPORIN NUP159
    Chains: C, F, I, L
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: TAIL, UNP RESIDUES 1425-1460
    Gene: NUP159, NUP158, RAT7, YIL115C
    Organism Common: YEAST
    Organism Scientific: SACCHAROMYCES CEREVISIAE
    Organism Taxid: 4932
    Synonym: NUCLEAR PORE PROTEIN NUP159

 Structural Features

(-) Chains, Units

  123456789101112
Asymmetric Unit : ABCDEFGHIJKL
Biological Unit 1 (1x): ABC         
Biological Unit 2 (1x):    DEF      
Biological Unit 3 (1x):       GHI   
Biological Unit 4 (1x):          JKL

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 40)

Asymmetric Unit (2, 40)
No.NameCountTypeFull Name
1MSE39Mod. Amino AcidSELENOMETHIONINE
2PGE1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 1 (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
2PGE-1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 2 (2, 11)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
2PGE1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 3 (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
2PGE-1Ligand/IonTRIETHYLENE GLYCOL
Biological Unit 4 (1, 9)
No.NameCountTypeFull Name
1MSE9Mod. Amino AcidSELENOMETHIONINE
2PGE-1Ligand/IonTRIETHYLENE GLYCOL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG D:247 , LYS D:251 , TYR D:276 , TRP D:337 , ASP D:338BINDING SITE FOR RESIDUE PGE D 6119

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 3PBP)

(-) Cis Peptide Bonds  (16, 16)

Asymmetric Unit
No.Residues
1Tyr A:209 -Pro A:210
2Gly A:283 -Pro A:284
3Asn A:288 -Pro A:289
4Ser B:973 -Pro B:974
5Tyr D:209 -Pro D:210
6Gly D:283 -Pro D:284
7Asn D:288 -Pro D:289
8Ser E:973 -Pro E:974
9Tyr G:209 -Pro G:210
10Gly G:283 -Pro G:284
11Asn G:288 -Pro G:289
12Ser H:973 -Pro H:974
13Tyr J:209 -Pro J:210
14Gly J:283 -Pro J:284
15Asn J:288 -Pro J:289
16Ser K:973 -Pro K:974

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3PBP)

(-) PROSITE Motifs  (1, 4)

Asymmetric Unit (1, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUP_CPS51434 NUP C-terminal domain profile.NU116_YEAST967-1109
 
 
 		  4B:967-1109
E:967-1109
H:967-1109
K:967-1109
Biological Unit 1 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUP_CPS51434 NUP C-terminal domain profile.NU116_YEAST967-1109
 
 
 		  1B:967-1109
-
-
-
Biological Unit 2 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUP_CPS51434 NUP C-terminal domain profile.NU116_YEAST967-1109
 
 
 		  1-
E:967-1109
-
-
Biological Unit 3 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUP_CPS51434 NUP C-terminal domain profile.NU116_YEAST967-1109
 
 
 		  1-
-
H:967-1109
-
Biological Unit 4 (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1NUP_CPS51434 NUP C-terminal domain profile.NU116_YEAST967-1109
 
 
 		  1-
-
-
K:967-1109

(-) Exons   (2, 8)

Asymmetric Unit (2, 8)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1YIL115C1YIL115C.1IX:148706-1443244383NU159_YEAST1-146014604C:1433-1458
F:1433-1458
I:1429-1456
L:1434-1457		26
26
28
24
2.1YMR047C1YMR047C.1XIII:366704-3633633342NU116_YEAST1-111311134B:966-1111
E:966-1111
H:966-1111
K:966-1111		146
146
146
146

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:438
 aligned with NUP82_YEAST | P40368 from UniProtKB/Swiss-Prot  Length:713

    Alignment length:446
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446      
         NUP82_YEAST      7 LSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISS  452
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........------.eeeeee....eeeeee..eeeeee.......eeee...........eeee.....eeeee...eeeeee.........hhhhhhh.eeeeee.hhh.--....eeeeee...hhhh.eeeeee....eeeee........eee.....eee.......eeeeee......eeeee.....eeeee......eee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.....eee.hhhhhh.......eee...hhhhhh.eeeeeeee......eeeeeee...eeeeeee.................eeeeeeeee......eee.......eeeee...eeeeeehhhhhhhhhhhhhhh.hhhhh......eeeeeee.....eeeeeee..eeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3pbp A    7 LSALPIFQAS------PRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVmEVPWGYSNVEDVSIQDAFQIFHYSIDEEE--PKSSIKKVLFHPKSYRDSCIVVLKEDDTITmFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVmYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEmSmSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFmSWASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALmSNKTLTFQNISS  452
                                    16      | 26        36        46        56        66        76        86    |   96       106       116   |  |126       136       146      |156       166       176       186       196       206       216       226      |236       246       256       266       276       286       296       306       316       326      |336       346       356       366       376       386|      396       406       416       426       436   |   446      
                                    16     23                                                                  91-MSE                      120  |                           153-MSE                                                                         233-MSE                                                                                             333-MSE                                               387-MSE                                              440-MSE        
                                                                                                                                              123                                                                                                                                                                                                                 335-MSE                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:146
 aligned with NU116_YEAST | Q02630 from UniProtKB/Swiss-Prot  Length:1113

    Alignment length:146
                                   975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
         NU116_YEAST    966 INENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhh...........eeee...eeeee..................eeee..eeee.................eeeee..................hhhhhhhhhhhh.....eeeee......eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -NUP_C  PDB: B:967-1109 UniProt: 967-1109                                                                                                       -- PROSITE
               Transcript 2 Exon 2.1  PDB: B:966-1111 UniProt: 1-1113 [INCOMPLETE]                                                                                             Transcript 2
                3pbp B  966 mNENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
                            |      975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
                            |                                                                                                                                                 
                          966-MSE                                                                                                                                             


Chain C from PDB  Type:PROTEIN  Length:26
 aligned with NU159_YEAST | P40477 from UniProtKB/Swiss-Prot  Length:1460

    Alignment length:26
                                  1442      1452      
         NU159_YEAST   1433 GFKVVEVGLAMNTKKQIGDFFKNLNM 1458
               SCOP domains -------------------------- SCOP domains
               CATH domains -------------------------- CATH domains
               Pfam domains -------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------- SAPs(SNPs)
                    PROSITE -------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:1433-1458 Transcript 1
                3pbp C 1433 GFKVVEVGLAmNTKKQIGDFFKNLNm 1458
                                  1442|     1452     |
                                   1443-MSE       1458-MSE


Chain D from PDB  Type:PROTEIN  Length:437
 aligned with NUP82_YEAST | P40368 from UniProtKB/Swiss-Prot  Length:713

    Alignment length:446
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446      
         NUP82_YEAST      7 LSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISS  452
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........-------.eeeeee....eeeeee..eeeeee.......eeee...........eeee.....eeeee...eeeeee.........hhhhhhh.eeeeee.hhh.--....eeeeee...hhhh.eeeeee....eeeee........eee.....eee.......eeeeee......eeeee.....eeeee......eee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.....eee.hhhhhh.......eee...hhhhhh.eeeeeeee......eeeeeee...eeeeeee.................eeeeeeeee......eee.......eeeee...eeeeeehhhhhhhhhhhhhhh.hhhhh......eeeeeee.....eeeeeee..eeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3pbp D    7 LSALPIFQA-------PRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVmEVPWGYSNVEDVSIQDAFQIFHYSIDEEE--PKSSIKKVLFHPKSYRDSCIVVLKEDDTITmFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVmYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEmSmSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFmSWASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALmSNKTLTFQNISS  452
                                    |-      | 26        36        46        56        66        76        86    |   96       106       116   |  |126       136       146      |156       166       176       186       196       206       216       226      |236       246       256       266       276       286       296       306       316       326      |336       346       356       366       376       386|      396       406       416       426       436   |   446      
                                   15      23                                                                  91-MSE                      120  |                           153-MSE                                                                         233-MSE                                                                                             333-MSE                                               387-MSE                                              440-MSE        
                                                                                                                                              123                                                                                                                                                                                                                 335-MSE                                                                                                                 


Chain E from PDB  Type:PROTEIN  Length:146
 aligned with NU116_YEAST | Q02630 from UniProtKB/Swiss-Prot  Length:1113

    Alignment length:146
                                   975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
         NU116_YEAST    966 INENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhh...........eeee...eeeee..................eeee..eeee.................eeeee..................hhhhhhhhhhhh.....eeeee......eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -NUP_C  PDB: E:967-1109 UniProt: 967-1109                                                                                                       -- PROSITE
               Transcript 2 Exon 2.1  PDB: E:966-1111 UniProt: 1-1113 [INCOMPLETE]                                                                                             Transcript 2
                3pbp E  966 mNENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
                            |      975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
                          966-MSE                                                                                                                                             


Chain F from PDB  Type:PROTEIN  Length:26
 aligned with NU159_YEAST | P40477 from UniProtKB/Swiss-Prot  Length:1460

    Alignment length:26
                                  1442      1452      
         NU159_YEAST   1433 GFKVVEVGLAMNTKKQIGDFFKNLNM 1458
               SCOP domains -------------------------- SCOP domains
               CATH domains -------------------------- CATH domains
               Pfam domains -------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------- SAPs(SNPs)
                    PROSITE -------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: F:1433-1458 Transcript 1
                3pbp F 1433 GFKVVEVGLAmNTKKQIGDFFKNLNm 1458
                                  1442|     1452     |
                                   1443-MSE       1458-MSE


Chain G from PDB  Type:PROTEIN  Length:438
 aligned with NUP82_YEAST | P40368 from UniProtKB/Swiss-Prot  Length:713

    Alignment length:446
                                    16        26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446      
         NUP82_YEAST      7 LSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISS  452
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhh..------.eeeeee....eeeeee..eeeeee.......eeee...........eeee.....eeeee...eeeeee.........hhhhhhh.eeeeee.hhh.--....eeeeee...hhhh.eeeeee....eeeee........eee.....eee.......eeeeee......eeeee.....eeeee......eee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.....eee.hhhhhh.......eee...hhhhhh.eeeeeeee......eeeeeee...eeeeee..................eeeeeeeee......eee.......eeeee...eeeeeehhhhhhhhhhhhhh..hhhhh......eeeeeee.....eeeeeee..eeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3pbp G    7 LSALPIFQAS------PRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVmEVPWGYSNVEDVSIQDAFQIFHYSIDEEE--PKSSIKKVLFHPKSYRDSCIVVLKEDDTITmFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVmYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEmSmSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFmSWASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALmSNKTLTFQNISS  452
                                    16      | 26        36        46        56        66        76        86    |   96       106       116   |  |126       136       146      |156       166       176       186       196       206       216       226      |236       246       256       266       276       286       296       306       316       326      |336       346       356       366       376       386|      396       406       416       426       436   |   446      
                                    16     23                                                                  91-MSE                      120  |                           153-MSE                                                                         233-MSE                                                                                             333-MSE                                               387-MSE                                              440-MSE        
                                                                                                                                              123                                                                                                                                                                                                                 335-MSE                                                                                                                 


Chain H from PDB  Type:PROTEIN  Length:146
 aligned with NU116_YEAST | Q02630 from UniProtKB/Swiss-Prot  Length:1113

    Alignment length:146
                                   975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
         NU116_YEAST    966 INENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhh...........eeee...eeeee..................eeee..eeee.................eeeee..................hhhhhhhhhhhhh....eeeee......eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -NUP_C  PDB: H:967-1109 UniProt: 967-1109                                                                                                       -- PROSITE
               Transcript 2 Exon 2.1  PDB: H:966-1111 UniProt: 1-1113 [INCOMPLETE]                                                                                             Transcript 2
                3pbp H  966 mNENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
                            |      975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
                          966-MSE                                                                                                                                             


Chain I from PDB  Type:PROTEIN  Length:28
 aligned with NU159_YEAST | P40477 from UniProtKB/Swiss-Prot  Length:1460

    Alignment length:28
                                  1438      1448        
         NU159_YEAST   1429 KDMKGFKVVEVGLAMNTKKQIGDFFKNL 1456
               SCOP domains ---------------------------- SCOP domains
               CATH domains ---------------------------- CATH domains
               Pfam domains ---------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------- SAPs(SNPs)
                    PROSITE ---------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: I:1429-1456   Transcript 1
                3pbp I 1429 KDmKGFKVVEVGLAmNTKKQIGDFFKNL 1456
                              |   1438    | 1448        
                              |        1443-MSE         
                           1431-MSE                     


Chain J from PDB  Type:PROTEIN  Length:439
 aligned with NUP82_YEAST | P40368 from UniProtKB/Swiss-Prot  Length:713

    Alignment length:447
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       
         NUP82_YEAST      6 RLSALPIFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKKVLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVMYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLTFQNISS  452
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhh..------.eeeeee....eeeeee..eeeeee.......eeee...........eeee.....eeeee...eeeeee.........hhhhhhh.eeeeee.hhh.--....eeeeee...hhhh.eeeeee....eeeee........eee.....eee.......eeeeee......eeeee.....eeeee......eee.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.....eee.hhhhhh.......eee...hhhhhh.eeeeeeee......eeeeeee...eeeeeee.................eeeeeeeee......eee.......eeeee...eeeeeehhhhhhhhhhhhhhh.hhhhh......eeeeeee.....eeeeeee..eeeeeee....eeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3pbp J    6 RLSALPIFQAS------PRYIFSSQNGTRIVFIQDNIIRWYNVLTDSLYHSLNFSRHLVLDDTFHVISSTSGDLLCLFNDNEIFVmEVPWGYSNVEDVSIQDAFQIFHYSIDEEE--PKSSIKKVLFHPKSYRDSCIVVLKEDDTITmFDILNSQEKPIVLNKPNNSFGLDARVNDITDLEFSKDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKDLNLILNKSLVmYESLDSTTDVIVKRNVIKQLQFVSKLHENWNSRFGKVDIQKEYRLAKVQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEmSmSWDVDNYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFmSWASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALmSNKTLTFQNISS  452
                                    15|      |25        35        45        55        65        75        85     |  95       105       115    |  125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385 |     395       405       415       425       435    |  445       
                                     16     23                                                                  91-MSE                      120  |                           153-MSE                                                                         233-MSE                                                                                             333-MSE                                               387-MSE                                              440-MSE        
                                                                                                                                               123                                                                                                                                                                                                                 335-MSE                                                                                                                 


Chain K from PDB  Type:PROTEIN  Length:146
 aligned with NU116_YEAST | Q02630 from UniProtKB/Swiss-Prot  Length:1113

    Alignment length:146
                                   975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
         NU116_YEAST    966 INENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeee.hhhhhhhh...........eeee...eeeee..................eeee..eeee.................eeeee..................hhhhhhhhhhhhh....eeeee......eeeee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -NUP_C  PDB: K:967-1109 UniProt: 967-1109                                                                                                       -- PROSITE
               Transcript 2 Exon 2.1  PDB: K:966-1111 UniProt: 1-1113 [INCOMPLETE]                                                                                             Transcript 2
                3pbp K  966 mNENYYISPSLDTLSSYSLLQLRKVPHLVVGHKSYGKIEFLEPVDLAGIPLTSLGGVIITFEPKTCIIYANLPNRPKRGEGINVRARITCFNCYPVDKSTRKPIKDPNHQLVKRHIERLKKNPNSKFESYDADSGTYVFIVNHAAE 1111
                            |      975       985       995      1005      1015      1025      1035      1045      1055      1065      1075      1085      1095      1105      
                          966-MSE                                                                                                                                             


Chain L from PDB  Type:PROTEIN  Length:24
 aligned with NU159_YEAST | P40477 from UniProtKB/Swiss-Prot  Length:1460

    Alignment length:24
                                  1443      1453    
         NU159_YEAST   1434 FKVVEVGLAMNTKKQIGDFFKNLN 1457
               SCOP domains ------------------------ SCOP domains
               CATH domains ------------------------ CATH domains
               Pfam domains ------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------ SAPs(SNPs)
                    PROSITE ------------------------ PROSITE
               Transcript 1 Exon 1.1 UniProt: 1-1460 Transcript 1
                3pbp L 1434 FKVVEVGLAmNTKKQIGDFFKNLN 1457
                                  1443      1453    
                                  1443-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3PBP)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3PBP)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3PBP)

(-) Gene Ontology  (33, 61)

Asymmetric Unit(hide GO term definitions)
Chain A,D,G,J   (NUP82_YEAST | P40368)
molecular function
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0017056    structural constituent of nuclear pore    The action of a molecule that contributes to the structural integrity of the nuclear pore complex.
    GO:0005215    transporter activity    Enables the directed movement of substances (such as macromolecules, small molecules, ions) into, out of or within a cell, or between cells.
biological process
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006611    protein export from nucleus    The directed movement of a protein from the nucleus into the cytoplasm.
    GO:0006606    protein import into nucleus    The directed movement of a protein from the cytoplasm to the nucleus.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0000055    ribosomal large subunit export from nucleus    The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
    GO:0000056    ribosomal small subunit export from nucleus    The directed movement of a ribosomal small subunit from the nucleus into the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0044614    nuclear pore cytoplasmic filaments    Filamentous extensions on cytoplasmic face of the nuclear pore complex (NPC). In S. cerevisiae, Nup159p, Nup82p, and Nup42p contribute to the cytoplasmic filaments. In vertebrates, Nup358 is a major component.
    GO:0044612    nuclear pore linkers    A substructure of the nuclear pore complex (NPC) that serves to connect members of the central transport channel (composed of FG-nucleoporins) to the core scaffold (composed of the inner and outer NPC rings). In S. cerevisiae, the linkers are Nic96p and Nup82p. In vertebrates, they are Nup93 and Nup88. Components are arranged in 8-fold symmetrical 'spokes' around the central transport channel. Both linkers can be isolated in association with specific FG-nucleoporins, complexes that are sometimes referred to as the Nic96 complex (Nic96p-Nsp1p-Nup49p-Nup57p) and the Nup82 complex (Nup82p-Nup116p-Nup159p-Gle2p).
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,E,H,K   (NU116_YEAST | Q02630)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0008139    nuclear localization sequence binding    Interacting selectively and non-covalently with a nuclear localization sequence, a specific peptide sequence that acts as a signal to localize the protein within the nucleus.
    GO:0005487    nucleocytoplasmic transporter activity    Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0017056    structural constituent of nuclear pore    The action of a molecule that contributes to the structural integrity of the nuclear pore complex.
biological process
    GO:0006406    mRNA export from nucleus    The directed movement of mRNA from the nucleus to the cytoplasm.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006999    nuclear pore organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of the nuclear pore.
    GO:0016973    poly(A)+ mRNA export from nucleus    The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
    GO:0000973    posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery    The chromosome organization process in which the DNA sequence containing a gene transcribed by RNA polymerase II is maintained in a specific location at the nuclear periphery even after transcription has been repressed.
    GO:0006606    protein import into nucleus    The directed movement of a protein from the cytoplasm to the nucleus.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0000055    ribosomal large subunit export from nucleus    The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
    GO:0006409    tRNA export from nucleus    The directed movement of tRNA from the nucleus to the cytoplasm.
    GO:0034398    telomere tethering at nuclear periphery    The process in which a telomere is maintained in a specific location at the nuclear periphery.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0044613    nuclear pore central transport channel    The central substructure of the nuclear pore complex (NPC), through which nucleocytoplasmic transport of RNAs, proteins and small molecules occurs. The central transport channel is filled with FG-nucleoporins, which form a selective barrier and provide a series of binding sites for transporter proteins. Characterized S. cerevisiae FG-nucleoporins include Nup159p, Nup145Np, Nup116p, Nup100p, Nsp1p, Nup57p, Nup49p, Nup42p, Nup53p, Nup59p/Asm4p, Nup60p and Nup1. Characterized vertebrate FG-nucleoporins include Nup214, Nup98, Nup62, Nup54, Nup58/45, NLP1, and Nup153.
    GO:0044614    nuclear pore cytoplasmic filaments    Filamentous extensions on cytoplasmic face of the nuclear pore complex (NPC). In S. cerevisiae, Nup159p, Nup82p, and Nup42p contribute to the cytoplasmic filaments. In vertebrates, Nup358 is a major component.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C,F,I,L   (NU159_YEAST | P40477)
molecular function
    GO:0000774    adenyl-nucleotide exchange factor activity    Stimulates the hydrolysis and exchange of adenyl nucleotides by other proteins.
    GO:0005487    nucleocytoplasmic transporter activity    Enables the directed movement of substances between the nucleus and the cytoplasm of a cell.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006607    NLS-bearing protein import into nucleus    The directed movement of a protein bearing a nuclear localization signal (NLS) from the cytoplasm into the nucleus, across the nuclear membrane.
    GO:0051028    mRNA transport    The directed movement of mRNA, messenger ribonucleic acid, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0097064    ncRNA export from nucleus    The directed movement of a non-coding RNA transcript (ncRNA) from the nucleus to the cytoplasm.
    GO:0031081    nuclear pore distribution    Any process that establishes the spatial arrangement of nuclear pores within the nuclear envelope.
    GO:0016973    poly(A)+ mRNA export from nucleus    The directed movement of poly(A)+ mRNA out of the nucleus into the cytoplasm.
    GO:0006611    protein export from nucleus    The directed movement of a protein from the nucleus into the cytoplasm.
    GO:0015031    protein transport    The directed movement of proteins into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0000055    ribosomal large subunit export from nucleus    The directed movement of a ribosomal large subunit from the nucleus into the cytoplasm.
    GO:0000056    ribosomal small subunit export from nucleus    The directed movement of a ribosomal small subunit from the nucleus into the cytoplasm.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0031965    nuclear membrane    Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
    GO:0005643    nuclear pore    Any of the numerous similar discrete openings in the nuclear envelope of a eukaryotic cell, where the inner and outer nuclear membranes are joined.
    GO:0044613    nuclear pore central transport channel    The central substructure of the nuclear pore complex (NPC), through which nucleocytoplasmic transport of RNAs, proteins and small molecules occurs. The central transport channel is filled with FG-nucleoporins, which form a selective barrier and provide a series of binding sites for transporter proteins. Characterized S. cerevisiae FG-nucleoporins include Nup159p, Nup145Np, Nup116p, Nup100p, Nsp1p, Nup57p, Nup49p, Nup42p, Nup53p, Nup59p/Asm4p, Nup60p and Nup1. Characterized vertebrate FG-nucleoporins include Nup214, Nup98, Nup62, Nup54, Nup58/45, NLP1, and Nup153.
    GO:0044614    nuclear pore cytoplasmic filaments    Filamentous extensions on cytoplasmic face of the nuclear pore complex (NPC). In S. cerevisiae, Nup159p, Nup82p, and Nup42p contribute to the cytoplasmic filaments. In vertebrates, Nup358 is a major component.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PGE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:288 - Pro A:289   [ RasMol ]  
    Asn D:288 - Pro D:289   [ RasMol ]  
    Asn G:288 - Pro G:289   [ RasMol ]  
    Asn J:288 - Pro J:289   [ RasMol ]  
    Gly A:283 - Pro A:284   [ RasMol ]  
    Gly D:283 - Pro D:284   [ RasMol ]  
    Gly G:283 - Pro G:284   [ RasMol ]  
    Gly J:283 - Pro J:284   [ RasMol ]  
    Ser B:973 - Pro B:974   [ RasMol ]  
    Ser E:973 - Pro E:974   [ RasMol ]  
    Ser H:973 - Pro H:974   [ RasMol ]  
    Ser K:973 - Pro K:974   [ RasMol ]  
    Tyr A:209 - Pro A:210   [ RasMol ]  
    Tyr D:209 - Pro D:210   [ RasMol ]  
    Tyr G:209 - Pro G:210   [ RasMol ]  
    Tyr J:209 - Pro J:210   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3pbp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NU116_YEAST | Q02630
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NU159_YEAST | P40477
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  NUP82_YEAST | P40368
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NU116_YEAST | Q02630
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NU159_YEAST | P40477
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  NUP82_YEAST | P40368
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NU116_YEAST | Q02630: 1o6p 2aiv
        NU159_YEAST | P40477: 1xip 3rrm 3tkn 4ds1
        NUP82_YEAST | P40368: 3tkn

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3PBP)