Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF RESPIRATORY COMPLEX I FROM THERMUS THERMOPHILUS
 
Authors :  R. G. Efremov, R. Baradaran, L. A. Sazanov
Date :  22 Mar 10  (Deposition) - 26 May 10  (Release) - 08 Sep 10  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  4.50
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H,J,L,M,N,O,P,Q,R,S,T,1,2,3,4,5,6,7,9
Biol. Unit 1:  H,L,M,N,R,1,2,3,4,5,6,7,9  (1x)
Biol. Unit 2:  A,B,C,D,E,F,G,J,O,P,Q,S,T  (1x)
Keywords :  Membrane Protein, Complex I, Oxidoreductase, Electron Transport, Respiratory Chain (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. G. Efremov, R. Baradaran, L. A. Sazanov
The Architecture Of Respiratory Complex I
Nature V. 465 441 2010
PubMed-ID: 20505720  |  Reference-DOI: 10.1038/NATURE09066

(-) Compounds

Molecule 1 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 1
    Chains1, A
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 1, NDH-1 SUBUNIT 1
 
Molecule 2 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 2
    Chains2, B
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 2, NDH-1 SUBUNIT 2
 
Molecule 3 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 3
    Chains3, C
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 3, NDH-1 SUBUNIT 3
 
Molecule 4 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 4
    Chains4, D
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 4, NDH-1 SUBUNIT 4
 
Molecule 5 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT C
    Chains5, E
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I SUBUNIT C, NDH-1 SUBUNIT 5
 
Molecule 6 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT B
    Chains6, F
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I SUBUNIT B, NDH-1 SUBUNIT 6
 
Molecule 7 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT I
    Chains9, G
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I SUBUNIT I, NDH-1 SUBUNIT 9
 
Molecule 8 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 15
    Chains7, J
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 15, NDH-1 SUBUNIT 15
 
Molecule 9 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 12
    ChainsL, O
    EC Number1.6.99.5
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
    SynonymNADH DEHYDROGENASE I CHAIN 12, NDH-1 SUBUNIT 12
 
Molecule 10 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 13
    ChainsM, P
    EC Number1.6.5.3
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
 
Molecule 11 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 14
    ChainsN, Q
    EC Number1.6.5.3
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
 
Molecule 12 - NADH-QUINONE OXIDOREDUCTASE SUBUNITS 7, 10 AND 11
    ChainsR, S
    EC Number1.6.5.3
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8
 
Molecule 13 - NADH-QUINONE OXIDOREDUCTASE SUBUNIT 8
    ChainsH, T
    EC Number1.6.5.3
    Organism ScientificTHERMUS THERMOPHILUS
    Organism Taxid300852
    StrainHB8

 Structural Features

(-) Chains, Units

  1234567891011121314151617181920212223242526
Asymmetric Unit ABCDEFGHJLMNOPQRST12345679
Biological Unit 1 (1x)       H LMN   R  12345679
Biological Unit 2 (1x)ABCDEFG J   OPQ ST        

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (4, 3406)

Asymmetric Unit (4, 3406)
No.NameCountTypeFull Name
1FES4Ligand/IonFE2/S2 (INORGANIC) CLUSTER
2FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
3SF414Ligand/IonIRON/SULFUR CLUSTER
4UNK3386Mod. Amino Acid
Biological Unit 1 (3, 10)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
2FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
3SF47Ligand/IonIRON/SULFUR CLUSTER
4UNK-1Mod. Amino Acid
Biological Unit 2 (3, 10)
No.NameCountTypeFull Name
1FES2Ligand/IonFE2/S2 (INORGANIC) CLUSTER
2FMN1Ligand/IonFLAVIN MONONUCLEOTIDE
3SF47Ligand/IonIRON/SULFUR CLUSTER
4UNK-1Mod. Amino Acid

(-) Sites  (20, 20)

Asymmetric Unit (20, 20)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREARG 4:84 , HIS 4:169 , CYS 6:45 , CYS 6:46 , GLY 6:82 , ARG 6:83 , ALA 6:110 , CYS 6:111 , CYS 6:140 , PRO 6:141BINDING SITE FOR RESIDUE SF4 6 182
02AC2SOFTWAREHIS 9:41 , CYS 9:63 , ILE 9:68 , CYS 9:98 , ILE 9:99 , PHE 9:100 , CYS 9:101 , GLY 9:102 , CYS 9:104BINDING SITE FOR RESIDUE SF4 9 183
03AC3SOFTWARECYS 9:53 , ILE 9:54 , CYS 9:56 , SER 9:57 , CYS 9:59 , CYS 9:108 , PRO 9:109 , THR 9:110 , ALA 9:112 , ILE 9:113BINDING SITE FOR RESIDUE SF4 9 184
04AC4SOFTWAREHIS 3:115 , ASP 3:118 , CYS 3:119 , CYS 3:122 , CYS 3:128 , LEU 3:130 , GLN 3:131 , VAL 3:232 , GLY 3:233BINDING SITE FOR RESIDUE SF4 3 784
05AC5SOFTWARECYS 3:181 , ILE 3:182 , CYS 3:184 , ARG 3:186 , CYS 3:187 , CYS 3:230 , PRO 3:231 , ALA 3:234BINDING SITE FOR RESIDUE SF4 3 785
06AC6SOFTWARECYS 3:256 , LEU 3:258 , CYS 3:259 , VAL 3:261 , GLY 3:262 , CYS 3:263 , CYS 3:291 , GLY 3:294 , PRO 3:407 , ILE 3:408BINDING SITE FOR RESIDUE SF4 3 786
07AC7SOFTWARELEU 3:32 , CYS 3:34 , SER 3:35 , GLY 3:43 , ALA 3:44 , CYS 3:45 , ARG 3:46 , CYS 3:48 , CYS 3:83BINDING SITE FOR RESIDUE FES 3 787
08AC8SOFTWAREPRO 1:199 , SER 1:352 , CYS 1:353 , GLY 1:354 , LYS 1:355 , CYS 1:356 , CYS 1:359 , CYS 1:400 , LEU 1:402 , ALA 1:403BINDING SITE FOR RESIDUE SF4 1 439
09AC9SOFTWARECYS 2:83 , THR 2:85 , SER 2:87 , CYS 2:88 , CYS 2:124 , LEU 2:125 , GLY 2:126 , SER 2:127 , CYS 2:128BINDING SITE FOR RESIDUE FES 2 182
10BC1SOFTWAREGLY 1:64 , GLY 1:66 , LYS 1:75 , ASN 1:92 , ASP 1:94 , SER 1:96 , GLY 1:183 , GLU 1:184 , GLU 1:185 , ILE 1:218 , ASN 1:219 , ASN 1:220 , THR 1:223 , PRO 1:401 , LEU 1:402BINDING SITE FOR RESIDUE FMN 1 440
11BC2SOFTWAREARG D:84 , HIS D:169 , CYS F:45 , CYS F:46 , GLY F:82 , ARG F:83 , ALA F:110 , CYS F:111 , CYS F:140 , PRO F:141BINDING SITE FOR RESIDUE SF4 F 182
12BC3SOFTWAREHIS G:41 , CYS G:63 , ILE G:68 , CYS G:98 , ILE G:99 , PHE G:100 , CYS G:101 , GLY G:102 , CYS G:104BINDING SITE FOR RESIDUE SF4 G 183
13BC4SOFTWARECYS G:53 , ILE G:54 , CYS G:56 , SER G:57 , CYS G:59 , CYS G:108 , PRO G:109 , THR G:110 , ALA G:112 , ILE G:113BINDING SITE FOR RESIDUE SF4 G 184
14BC5SOFTWAREHIS C:115 , ASP C:118 , CYS C:119 , CYS C:122 , CYS C:128 , LEU C:130 , GLN C:131 , VAL C:232 , GLY C:233BINDING SITE FOR RESIDUE SF4 C 784
15BC6SOFTWARECYS C:181 , ILE C:182 , CYS C:184 , ARG C:186 , CYS C:187 , CYS C:230 , PRO C:231 , ALA C:234BINDING SITE FOR RESIDUE SF4 C 785
16BC7SOFTWARECYS C:256 , LEU C:258 , CYS C:259 , VAL C:261 , GLY C:262 , CYS C:263 , CYS C:291 , GLY C:294 , PRO C:407 , ILE C:408BINDING SITE FOR RESIDUE SF4 C 786
17BC8SOFTWARELEU C:32 , CYS C:34 , SER C:35 , GLY C:43 , ALA C:44 , CYS C:45 , ARG C:46 , CYS C:48 , CYS C:83BINDING SITE FOR RESIDUE FES C 787
18BC9SOFTWAREPRO A:199 , SER A:352 , CYS A:353 , GLY A:354 , LYS A:355 , CYS A:356 , CYS A:359 , CYS A:400 , LEU A:402 , ALA A:403BINDING SITE FOR RESIDUE SF4 A 439
19CC1SOFTWARECYS B:83 , THR B:85 , SER B:87 , CYS B:88 , CYS B:124 , LEU B:125 , GLY B:126 , SER B:127 , CYS B:128BINDING SITE FOR RESIDUE FES B 182
20CC2SOFTWAREGLY A:64 , GLY A:66 , LYS A:75 , ASN A:92 , ASP A:94 , SER A:96 , GLY A:183 , GLU A:184 , GLU A:185 , ILE A:218 , ASN A:219 , ASN A:220 , THR A:223 , PRO A:401 , LEU A:402BINDING SITE FOR RESIDUE FMN A 440

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
12:144 -2:172
2B:144 -B:172

(-) Cis Peptide Bonds  (8, 8)

Asymmetric Unit
No.Residues
1Ala 2:131 -Pro 2:132
2Cys 6:140 -Pro 6:141
3Unk M:1212 -Unk M:1213
4Unk N:1212 -Unk N:1213
5Ala B:131 -Pro B:132
6Cys F:140 -Pro F:141
7Unk P:1212 -Unk P:1213
8Unk Q:1212 -Unk Q:1213

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 3M9S)

(-) PROSITE Motifs  (13, 30)

Asymmetric Unit (13, 30)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.NQO3_THET81-99
 
  23:1-99
C:1-99
2COMPLEX1_75K_1PS00641 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 1.NQO3_THET831-48
 
  23:31-48
C:31-48
34FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.NQO9_THET843-73
 
89-118
 
  49:43-73
G:43-73
9:89-118
G:89-118
44FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.NQO9_THET853-64
 
98-109
 
  49:53-64
G:53-64
9:98-109
G:98-109
5COMPLEX1_49KPS00535 Respiratory chain NADH dehydrogenase 49 Kd subunit signature.NQO4_THET862-73
 
  24:62-73
D:62-73
6COMPLEX1_24KPS01099 Respiratory-chain NADH dehydrogenase 24 Kd subunit signature.NQO2_THET8114-132
 
  22:114-132
B:114-132
7COMPLEX1_30KPS00542 Respiratory chain NADH dehydrogenase 30 Kd subunit signature.NQO5_THET8115-136
 
  25:115-136
E:115-136
8COMPLEX1_75K_2PS00642 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 2.NQO3_THET8119-131
 
  23:119-131
C:119-131
9COMPLEX1_20KPS01150 Respiratory-chain NADH dehydrogenase 20 Kd subunit signature.NQO6_THET8126-142
 
  26:126-142
F:126-142
10COMPLEX1_51K_1PS00644 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 1.NQO1_THET8176-191
 
  21:176-191
A:176-191
11COMPLEX1_75K_3PS00643 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 3.NQO3_THET8180-190
 
  23:180-190
C:180-190
124FE4S_MOW_BIS_MGDPS51669 Prokaryotic molybdopterin oxidoreductases 4Fe-4S domain profile.NQO3_THET8249-305
 
  23:249-305
C:249-305
13COMPLEX1_51K_2PS00645 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 2.NQO1_THET8351-362
 
  21:351-362
A:351-362
Biological Unit 1 (13, 15)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.NQO3_THET81-99
 
  13:1-99
-
2COMPLEX1_75K_1PS00641 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 1.NQO3_THET831-48
 
  13:31-48
-
34FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.NQO9_THET843-73
 
89-118
 
  29:43-73
-
9:89-118
-
44FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.NQO9_THET853-64
 
98-109
 
  29:53-64
-
9:98-109
-
5COMPLEX1_49KPS00535 Respiratory chain NADH dehydrogenase 49 Kd subunit signature.NQO4_THET862-73
 
  14:62-73
-
6COMPLEX1_24KPS01099 Respiratory-chain NADH dehydrogenase 24 Kd subunit signature.NQO2_THET8114-132
 
  12:114-132
-
7COMPLEX1_30KPS00542 Respiratory chain NADH dehydrogenase 30 Kd subunit signature.NQO5_THET8115-136
 
  15:115-136
-
8COMPLEX1_75K_2PS00642 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 2.NQO3_THET8119-131
 
  13:119-131
-
9COMPLEX1_20KPS01150 Respiratory-chain NADH dehydrogenase 20 Kd subunit signature.NQO6_THET8126-142
 
  16:126-142
-
10COMPLEX1_51K_1PS00644 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 1.NQO1_THET8176-191
 
  11:176-191
-
11COMPLEX1_75K_3PS00643 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 3.NQO3_THET8180-190
 
  13:180-190
-
124FE4S_MOW_BIS_MGDPS51669 Prokaryotic molybdopterin oxidoreductases 4Fe-4S domain profile.NQO3_THET8249-305
 
  13:249-305
-
13COMPLEX1_51K_2PS00645 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 2.NQO1_THET8351-362
 
  11:351-362
-
Biological Unit 2 (13, 15)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
12FE2S_FER_2PS51085 2Fe-2S ferredoxin-type iron-sulfur binding domain profile.NQO3_THET81-99
 
  1-
C:1-99
2COMPLEX1_75K_1PS00641 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 1.NQO3_THET831-48
 
  1-
C:31-48
34FE4S_FER_2PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.NQO9_THET843-73
 
89-118
 
  2-
G:43-73
-
G:89-118
44FE4S_FER_1PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.NQO9_THET853-64
 
98-109
 
  2-
G:53-64
-
G:98-109
5COMPLEX1_49KPS00535 Respiratory chain NADH dehydrogenase 49 Kd subunit signature.NQO4_THET862-73
 
  1-
D:62-73
6COMPLEX1_24KPS01099 Respiratory-chain NADH dehydrogenase 24 Kd subunit signature.NQO2_THET8114-132
 
  1-
B:114-132
7COMPLEX1_30KPS00542 Respiratory chain NADH dehydrogenase 30 Kd subunit signature.NQO5_THET8115-136
 
  1-
E:115-136
8COMPLEX1_75K_2PS00642 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 2.NQO3_THET8119-131
 
  1-
C:119-131
9COMPLEX1_20KPS01150 Respiratory-chain NADH dehydrogenase 20 Kd subunit signature.NQO6_THET8126-142
 
  1-
F:126-142
10COMPLEX1_51K_1PS00644 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 1.NQO1_THET8176-191
 
  1-
A:176-191
11COMPLEX1_75K_3PS00643 Respiratory-chain NADH dehydrogenase 75 Kd subunit signature 3.NQO3_THET8180-190
 
  1-
C:180-190
124FE4S_MOW_BIS_MGDPS51669 Prokaryotic molybdopterin oxidoreductases 4Fe-4S domain profile.NQO3_THET8249-305
 
  1-
C:249-305
13COMPLEX1_51K_2PS00645 Respiratory-chain NADH dehydrogenase 51 Kd subunit signature 2.NQO1_THET8351-362
 
  1-
A:351-362

(-) Exons   (0, 0)

(no "Exon" information available for 3M9S)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:437
 aligned with NQO1_THET8 | Q56222 from UniProtKB/Swiss-Prot  Length:438

    Alignment length:437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
          NQO1_THET8      2 TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR  438
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........................hhhhhh....hhhhhhhh...hhhhhhhhh.............hhhhh...........eeeee..........hhhhhhh.hhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhhhh.......hhh.....eeeeee....hhhh.hhhhhhhh..................hhh..eeeeehhhhh.hhhhhh..hhhhh.........eeeeeee......eeeeee....hhhhhh.........eeeee........ee..hhhh.........hhh.......eeeeee....hhhhhhhhhhhhhhh.....hhhh.....hhhhhhhhh......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COMPLEX1_51K_1  ---------------------------------------------------------------------------------------------------------------------------------------------------------------COMPLEX1_51K---------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 1    2 TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR  438
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       

Chain 2 from PDB  Type:PROTEIN  Length:178
 aligned with NQO2_THET8 | Q56221 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:178
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        
          NQO2_THET8      3 FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE  180
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhh........hhhhhhhhhhhhhhh....hhhhhhhhhhh...hhhhhhhh.............eeeeee..hhhh...hhhhhhhhhhhh............eeeeee.....hhh...ee...........hhhhhhhhhhhh....hhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------COMPLEX1_24K       ------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 2    3 FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE  180
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        

Chain 3 from PDB  Type:PROTEIN  Length:754
 aligned with NQO3_THET8 | Q56223 from UniProtKB/Swiss-Prot  Length:783

    Alignment length:777
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       
          NQO3_THET8      1 MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLV  777
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee....eeee.....hhhhhhh.......................eeeee..-----------------.......ee.........eeee...hhhhhhhhhhhhhhh............hhh.hhhhhhhhh......------..................eeee..eee.........hhhhhhhh.......ee........ee.............hhhh.....eeehhh.........eeeeee........eeeeeee..eeeeeee............hhhhh.............eee....eee..hhhhhhhhhhhhh......eeeee.......hhhhhhhhhhh.....eee.......hhh.....hhhhhh...eeee..hhhh..hhhhhhhhhh..............................eeeee....hhh....eeee.....hhhhhhhhh......hhhhhhhhhhhh....eeee..hhhh.hhhhhhhhhhhhh....eee......hhhhhhh.................eeee.....hhhh....eeee..............ee.....hhh..eeee.....eeee............hhhhhhhhhh..........hhhhhhhhhhh........................eeeee....hhh....hhhh...eeee.hhhhhh.......eeeeee..eeeeeeeee........eeeee.......ee..ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 2FE2S_FER_2  PDB: 3:1-99 UniProt: 1-99                                                             -----------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_MOW_BIS_MGD  PDB: 3:249-305 UniProt: 249-305       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------COMPLEX1_75K_1    -----------------------------------------------------------------------------------------------------------------------------------COMPLEX1_75----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------COMPLEX1_75K_---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 3    1 MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLP-----------------IQWQPKLAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKY------ELPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLV  777
                                    10        20        30        40        50    |    -         -  |     80        90       100       110       120       130       140  |    150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       
                                                                                 55                73                                                                   143    150                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   

Chain 4 from PDB  Type:PROTEIN  Length:377
 aligned with NQO4_THET8 | Q56220 from UniProtKB/Swiss-Prot  Length:409

    Alignment length:384
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405    
          NQO4_THET8     26 MTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR  409
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ......-------...ee.............ee.......hhhhhhh....hhhh..........hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhh....hhhhh.......hhhhhhh.......hhh.....hhhh.....hhh............hhhhhhhhhhhhhhhhhhhhhhhh..................hhhhh..hhhhhhhhhhhh.......eeee..eee..eeeeeeeee.......eeeee.hhhh..............hhh.hhhh.....hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------COMPLEX1_49K------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3m9s 4   26 MTLNVG-------GVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR  409
                                 |   -   |    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405    
                                31      39                                                                                                                                                                                                                                                                                                                                                                                  

Chain 5 from PDB  Type:PROTEIN  Length:196
 aligned with NQO5_THET8 | Q56219 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      
          NQO5_THET8      1 MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLW  196
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhh.............eee..hhhhhhhhhhhhh.....eeeeeeee...........eeeeeee.............eeeeeee................hhhhhhhhhh....................................ee.....ee.hhh.................hhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------COMPLEX1_30K          ------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 5    1 MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLW  196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      

Chain 6 from PDB  Type:PROTEIN  Length:145
 aligned with NQO6_THET8 | Q56218 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:161
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174 
          NQO6_THET8     15 EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA  175
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhh......eeee...hhhhh.......----------------....eeee.......hhhhhhhhh.......eeeehhhhh.............hhh.....eee......hhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------COMPLEX1_20K     --------------------------------- PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 6   15 EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAR----------------QADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA  175
                                    24        34        44        54  |      -        74        84        94       104       114       124       134       144       154       164       174 
                                                                     57               74                                                                                                     

Chain 7 from PDB  Type:PROTEIN  Length:127
 aligned with NQO15_THET8 | Q5SKZ7 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:127
                                    12        22        32        42        52        62        72        82        92       102       112       122       
         NQO15_THET8      3 ASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA  129
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh....eeeeee.hhhh............eeeeeee.....eeeeeee.........eeeee....eeeeeeee...eeee..ee..hhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 7    3 ASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA  129
                                    12        22        32        42        52        62        72        82        92       102       112       122       

Chain 9 from PDB  Type:PROTEIN  Length:154
 aligned with NQO9_THET8 | Q56224 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:154
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175    
          NQO9_THET8     26 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG  179
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee........eee..............hhhhh.....eeeeee.............eeeeeeee........hhhhh.....eee..........hhhhee.hhhh.......hhhhhh...........ee.....hhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------4FE4S_FER_1 ------------------------4FE4S_FER_2  PDB: 9:89-118    ------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------4FE4S_FER_2  PDB: 9:43-73      ------------------------4FE4S_FER_1 ---------------------------------------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s 9   26 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG  179
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175    

Chain A from PDB  Type:PROTEIN  Length:437
 aligned with NQO1_THET8 | Q56222 from UniProtKB/Swiss-Prot  Length:438

    Alignment length:437
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       
          NQO1_THET8      2 TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR  438
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------------------------------------------------Complex1_51K-3m9sA01 A:57-229                                                                                                                                                ---------------------SLBB-3m9sA03 A:251-300                            -------------------------------------NADH_4Fe-4S-3m9sA05 A:338-384                  ------------------------------------------------------ Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------Complex1_51K-3m9sA02 A:57-229                                                                                                                                                ---------------------SLBB-3m9sA04 A:251-300                            -------------------------------------NADH_4Fe-4S-3m9sA06 A:338-384                  ------------------------------------------------------ Pfam domains (2)
         Sec.struct. author ...........................hhhhhh....hhhhhhhh...hhhhhhhhh.............hhhhh...........eeeee..........hhhhhhh.hhhhhhhhhhhhhhh...eeeeee....hhhhhhhhhhhhhhhh.......hhh.....eeeeee....hhhh.hhhhhhhh..................hhh..eeeeehhhhh.hhhhhh..hhhhh.........eeeeeee......eeeeee....hhhhhh.........eeeee........ee..hhhh.........hhh.......eeeeee....hhhhhhhhhhhhhhh.....hhhh.....hhhhhhhhh......hhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------COMPLEX1_51K_1  ---------------------------------------------------------------------------------------------------------------------------------------------------------------COMPLEX1_51K---------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s A    2 TGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR  438
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       

Chain B from PDB  Type:PROTEIN  Length:178
 aligned with NQO2_THET8 | Q56221 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:178
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        
          NQO2_THET8      3 FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE  180
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --------Complex1_24kDa-3m9sB01 B:11-158                                                                                                                     ---------------------- Pfam domains (1)
           Pfam domains (2) --------Complex1_24kDa-3m9sB02 B:11-158                                                                                                                     ---------------------- Pfam domains (2)
         Sec.struct. author .....hhhhhhhh........hhhhhhhhhhhhhhh....hhhhhhhhhhh...hhhhhhhh.............eeeeee..hhhh...hhhhhhhhhhhh............eeeeee.....hhh...ee...........hhhhhhhhhhhh....hhh............... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------COMPLEX1_24K       ------------------------------------------------ PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s B    3 FFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE  180
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172        

Chain C from PDB  Type:PROTEIN  Length:754
 aligned with NQO3_THET8 | Q56223 from UniProtKB/Swiss-Prot  Length:783

    Alignment length:777
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       
          NQO3_THET8      1 MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLV  777
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) --Fer2-3m9sC03 C:3-88                                                                   ---------------NADH-G_4Fe-4S_3-3m9sC11 C:104-143             ---------------------------------------------------------------------------------------------------Molybdop_Fe4S4-3m9sC05 C:249-303                       -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Molybdopterin-3m9sC07 C:573-647                                            ------------------------------------------------Molydop_binding-3m9sC01 C:696-769                                         -------- Pfam domains (1)
           Pfam domains (2) --Fer2-3m9sC04 C:3-88                                                                   ---------------NADH-G_4Fe-4S_3-3m9sC12 C:104-143             ---------------------------------------------------------------------------------------------------Molybdop_Fe4S4-3m9sC06 C:249-303                       -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Molybdopterin-3m9sC08 C:573-647                                            ------------------------------------------------Molydop_binding-3m9sC02 C:696-769                                         -------- Pfam domains (2)
           Pfam domains (3) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Molybdopterin-3m9sC09 C:573-647                                            ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Molybdopterin-3m9sC10 C:573-647                                            ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .eeee....eeee.....hhhhhhh.......................eeeee..-----------------.......ee.........eeee...hhhhhhhhhhhhhhh............hhh.hhhhhhhhh......------..................eeee..eee.........hhhhhhhh.......ee........ee.............hhhh.....eeehhh.........eeeeee........eeeeeee..eeeeeee............hhhhh.............eee....eee..hhhhhhhhhhhhh......eeeee.......hhhhhhhhhhh.....eee.......hhh.....hhhhhh...eeee..hhhh..hhhhhhhhhh..............................eeeee....hhh....eeee.....hhhhhhhhh......hhhhhhhhhhhh....eeee..hhhh.hhhhhhhhhhhhh....eee......hhhhhhh.................eeee.....hhhh....eeee..............ee.....hhh..eeee.....eeee............hhhhhhhhhh..........hhhhhhhhhhh........................eeeee....hhh....hhhh...eeee.hhhhhh.......eeeeee..eeeeeeeee........eeeee.......ee..ee.. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) 2FE2S_FER_2  PDB: C:1-99 UniProt: 1-99                                                             -----------------------------------------------------------------------------------------------------------------------------------------------------4FE4S_MOW_BIS_MGD  PDB: C:249-305 UniProt: 249-305       ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) ------------------------------COMPLEX1_75K_1    -----------------------------------------------------------------------------------------------------------------------------------COMPLEX1_75----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------COMPLEX1_75K_---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s C    1 MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLP-----------------IQWQPKLAASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKY------ELPVYTRFEFTRRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTARFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEATWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLGDPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLALLGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDEPGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQVLALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHPETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLV  777
                                    10        20        30        40        50    |    -         -  |     80        90       100       110       120       130       140  |    150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460       470       480       490       500       510       520       530       540       550       560       570       580       590       600       610       620       630       640       650       660       670       680       690       700       710       720       730       740       750       760       770       
                                                                                 55                73                                                                   143    150                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                   

Chain D from PDB  Type:PROTEIN  Length:377
 aligned with NQO4_THET8 | Q56220 from UniProtKB/Swiss-Prot  Length:409

    Alignment length:384
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405    
          NQO4_THET8     26 MTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR  409
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -----------------------------------------------------------------------------------------------------------------Complex1_49kDa-3m9sD01 D:139-409                                                                                                                                                                                                                                                Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------------------------------------------------------Complex1_49kDa-3m9sD02 D:139-409                                                                                                                                                                                                                                                Pfam domains (2)
         Sec.struct. author ......-------...ee.............ee.......hhhhhhh....hhhh..........hhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh.....................hhhhhhhhhhhhhhhhhhhhhhhh....hhhhh.......hhhhhhh.......hhh.....hhhh.....hhh............hhhhhhhhhhhhhhhhhhhhhhhh..................hhhhh..hhhhhhhhhhhh.......eeee..eee..eeeeeeeee.......eeeee.hhhh..............hhh.hhhh.....hhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------COMPLEX1_49K------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (3)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3m9s D   26 MTLNVG-------GVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNITYTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLFEWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLRASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETSMEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASLDPVMGDVDR  409
                                 |   -   |    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405    
                                31      39                                                                                                                                                                                                                                                                                                                                                                                  

Chain E from PDB  Type:PROTEIN  Length:196
 aligned with NQO5_THET8 | Q56219 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      
          NQO5_THET8      1 MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLW  196
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------Complex1_30kDa-3m9sE01 E:36-148                                                                                  ------------------------------------------------ Pfam domains (1)
           Pfam domains (2) -----------------------------------Complex1_30kDa-3m9sE02 E:36-148                                                                                  ------------------------------------------------ Pfam domains (2)
         Sec.struct. author ...hhhhhhhhh.............eee..hhhhhhhhhhhhh.....eeeeeeee...........eeeeeee.............eeeeeee................hhhhhhhhhh....................................ee.....ee.hhh.................hhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ------------------------------------------------------------------------------------------------------------------COMPLEX1_30K          ------------------------------------------------------------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s E    1 MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGWKDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFREGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLW  196
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190      

Chain F from PDB  Type:PROTEIN  Length:145
 aligned with NQO6_THET8 | Q56218 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:161
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174 
          NQO6_THET8     15 EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA  175
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------Oxidored_q6-3m                9sF01 F:44-154                                                                   --------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------Oxidored_q6-3m                9sF02 F:44-154                                                                   --------------------- Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhh......eeee...hhhhh.......----------------....eeee.......hhhhhhhhh.......eeeehhhhh.............hhh.....eee......hhhhhhhhhhhhhhh................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ---------------------------------------------------------------------------------------------------------------COMPLEX1_20K     --------------------------------- PROSITE (4)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s F   15 EREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDAR----------------QADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRGQAYNERGERLPPVAA  175
                                    24        34        44        54  |      -        74        84        94       104       114       124       134       144       154       164       174 
                                                                     57               74                                                                                                     

Chain G from PDB  Type:PROTEIN  Length:154
 aligned with NQO9_THET8 | Q56224 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:154
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175    
          NQO9_THET8     26 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG  179
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----------------------------------------------------------------Fer4-3m9sG01 G:91-114   ----------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------------------------Fer4-3m9sG02 G:91-114   ----------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) -----------------------------------------------------------------Fer4-3m9sG03 G:91-114   ----------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) -----------------------------------------------------------------Fer4-3m9sG04 G:91-114   ----------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .....ee........eee..............hhhhh.....eeeeee.............eeeeeeee........hhhhh.....eee..........hhhhee.hhhh.......hhhhhh...........ee.....hhh......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------4FE4S_FER_1 ------------------------4FE4S_FER_2  PDB: G:89-118    ------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -----------------4FE4S_FER_2  PDB: G:43-73      ------------------------4FE4S_FER_1 ---------------------------------------------------------------------- PROSITE (3)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s G   26 YPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVGYVVPYVRPELEGFKAPTEG  179
                                    35        45        55        65        75        85        95       105       115       125       135       145       155       165       175    

Chain H from PDB  Type:PROTEIN  Length:181
                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s H  101 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx  834
                            |||||||110|||||||120|||||||130|||||||210|||||||300|||||||310|||||||320|||||||407|||||||502|||||||512|||||||601|||||||611|||||||621|||||||705|||||||715|||||||806|||||||823|||||||833|
                          101-UNK||110-UNK||119-UNK||128-UNK||207-UNK||216-UNK||305-UNK||314-UNK||400-UNK||409-UNK||503-UNK||512-UNK||600-UNK||609-UNK||618-UNK||701-UNK||710-UNK||800-UNK||809-UNK||825-UNK||834-UNK
                           102-UNK||111-UNK||120-UNK||129-UNK||208-UNK||217-UNK||306-UNK||315-UNK||401-UNK||410-UNK||504-UNK||513-UNK||601-UNK||610-UNK||619-UNK||702-UNK||711-UNK||801-UNK||810-UNK||826-UNK||| 
                            103-UNK||112-UNK||121-UNK||130-UNK||209-UNK||218-UNK||307-UNK||316-UNK||402-UNK||411-UNK||505-UNK||514-UNK||602-UNK||611-UNK||620-UNK||703-UNK||712-UNK||802-UNK||811-UNK||827-UNK|| 
                             104-UNK| 113-UNK| 122-UNK| 201-UNK| 210-UNK| 219-UNK| 308-UNK| 317-UNK| 403-UNK| 412-UNK| 506-UNK| 515-UNK| 603-UNK| 612-UNK| 621-UNK| 704-UNK| 713-UNK| 803-UNK| 812-UNK| 828-UNK| 
                              105-UNK  114-UNK  123-UNK  202-UNK  211-UNK  300-UNK  309-UNK  318-UNK  404-UNK  413-UNK  507-UNK  516-UNK  604-UNK  613-UNK  622-UNK  705-UNK  714-UNK  804-UNK  820-UNK  829-UNK 
                               106-UNK  115-UNK  124-UNK  203-UNK  212-UNK  301-UNK  310-UNK  319-UNK  405-UNK  414-UNK  508-UNK  517-UNK  605-UNK  614-UNK  623-UNK  706-UNK  715-UNK  805-UNK  821-UNK  830-UNK
                                107-UNK  116-UNK  125-UNK  204-UNK  213-UNK  302-UNK  311-UNK  320-UNK  406-UNK  500-UNK  509-UNK  518-UNK  606-UNK  615-UNK  624-UNK  707-UNK  716-UNK  806-UNK  822-UNK  831-UNK
                                 108-UNK  117-UNK  126-UNK  205-UNK  214-UNK  303-UNK  312-UNK  321-UNK  407-UNK  501-UNK  510-UNK  519-UNK  607-UNK  616-UNK  625-UNK  708-UNK  717-UNK  807-UNK  823-UNK  832-UNK
                                  109-UNK  118-UNK  127-UNK  206-UNK  215-UNK  304-UNK  313-UNK  322-UNK  408-UNK  502-UNK  511-UNK  520-UNK  608-UNK  617-UNK  700-UNK  709-UNK  718-UNK  808-UNK  824-UNK  833-UNK

Chain J from PDB  Type:PROTEIN  Length:127
 aligned with NQO15_THET8 | Q5SKZ7 from UniProtKB/Swiss-Prot  Length:129

    Alignment length:127
                                    12        22        32        42        52        62        72        82        92       102       112       122       
         NQO15_THET8      3 ASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA  129
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) NADH_Oxid_Nqo15-3m9sJ01 J:3-129                                                                                                 Pfam domains (1)
           Pfam domains (2) NADH_Oxid_Nqo15-3m9sJ02 J:3-129                                                                                                 Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhh....eeeeee.hhhh............eeeeeee.....eeeeeee.........eeeee....eeeeeeee...eeee..ee..hhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s J    3 ASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLKRIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA  129
                                    12        22        32        42        52        62        72        82        92       102       112       122       

Chain L from PDB  Type:PROTEIN  Length:469
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.hhhh..hhhhh......hhhhhh..hhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s L  102 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 1622
                            |||||||111|||||||121|||||||204|||||||214|||||||224|||||||305|||||||353|||||||403|||||||413|||||||423|||||||499|||||||509|||||||519|||||||609|||||||655|||||||665|||||||712|||||||722|||||||732|||||||811|||||||821|||||||907|||||||917||||||1007||||||1017||||||1054||||||1103||||||1113||||||1123||||||1204||||||1214||||||1303||||||1313||||||1323||||||1407||||||1417||||||1510||||||1520||||||1531||||||1542||||||1553||||||1563||||||1578||||||1588||||||1603||||||1613|||||||||
                            ||||||110-UNK||119-UNK||201-UNK||210-UNK||219-UNK||228-UNK||308-UNK||355-UNK||404-UNK||413-UNK||422-UNK||497-UNK||506-UNK||515-UNK||604-UNK||613-UNK||658-UNK||704-UNK||713-UNK||722-UNK||731-UNK||809-UNK||818-UNK||903-UNK||912-UNK||921-UNK|1010-UNK|1019-UNK|1055-UNK|1103-UNK|1112-UNK|1121-UNK|1201-UNK|1210-UNK|1298-UNK|1307-UNK|1316-UNK|1325-UNK|1408-UNK|1417-UNK|1509-UNK|1518-UNK|1528-UNK|1538-UNK|1548-UNK|1557-UNK|1571-UNK|1580-UNK|1589-UNK|1603-UNK|1612-UNK|1621-UNK
                          102-UNK||111-UNK||120-UNK||202-UNK||211-UNK||220-UNK||229-UNK||309-UNK||356-UNK||405-UNK||414-UNK||423-UNK||498-UNK||507-UNK||516-UNK||605-UNK||650-UNK||659-UNK||705-UNK||714-UNK||723-UNK||732-UNK||810-UNK||819-UNK||904-UNK||913-UNK||922-UNK|1011-UNK|1020-UNK|1056-UNK|1104-UNK|1113-UNK|1122-UNK|1202-UNK|1211-UNK|1299-UNK|1308-UNK|1317-UNK|1326-UNK|1409-UNK|1501-UNK|1510-UNK|1519-UNK|1529-UNK|1539-UNK|1549-UNK|1558-UNK|1572-UNK|1581-UNK|1590-UNK|1604-UNK|1613-UNK|1622-UNK
                           103-UNK||112-UNK||121-UNK||203-UNK||212-UNK||221-UNK||301-UNK||310-UNK||357-UNK||406-UNK||415-UNK||424-UNK||499-UNK||508-UNK||517-UNK||606-UNK||651-UNK||660-UNK||706-UNK||715-UNK||724-UNK||802-UNK||811-UNK||820-UNK||905-UNK||914-UNK|1003-UNK|1012-UNK|1021-UNK|1057-UNK|1105-UNK|1114-UNK|1123-UNK|1203-UNK|1212-UNK|1300-UNK|1309-UNK|1318-UNK|1401-UNK|1410-UNK|1502-UNK|1511-UNK|1520-UNK|1530-UNK|1540-UNK|1550-UNK|1559-UNK|1573-UNK|1582-UNK|1591-UNK|1605-UNK|1614-UNK||  
                            104-UNK| 113-UNK| 122-UNK| 204-UNK| 213-UNK| 222-UNK| 302-UNK| 311-UNK| 358-UNK| 407-UNK| 416-UNK| 425-UNK| 500-UNK| 509-UNK| 518-UNK| 607-UNK| 652-UNK| 661-UNK| 707-UNK| 716-UNK| 725-UNK| 803-UNK| 812-UNK| 821-UNK| 906-UNK| 915-UNK|1004-UNK|1013-UNK|1022-UNK|1058-UNK|1106-UNK|1115-UNK|1195-UNK|1204-UNK|1213-UNK|1301-UNK|1310-UNK|1319-UNK|1402-UNK|1411-UNK|1503-UNK|1512-UNK|1522-UNK|1531-UNK|1541-UNK|1551-UNK|1560-UNK|1574-UNK|1583-UNK|1592-UNK|1606-UNK|1615-UNK|  
                             105-UNK  114-UNK  123-UNK  205-UNK  214-UNK  223-UNK  303-UNK  350-UNK  359-UNK  408-UNK  417-UNK  426-UNK  501-UNK  510-UNK  519-UNK  608-UNK  653-UNK  662-UNK  708-UNK  717-UNK  726-UNK  804-UNK  813-UNK  822-UNK  907-UNK  916-UNK 1005-UNK 1014-UNK 1050-UNK 1059-UNK 1107-UNK 1116-UNK 1196-UNK 1205-UNK 1214-UNK 1302-UNK 1311-UNK 1320-UNK 1403-UNK 1412-UNK 1504-UNK 1513-UNK 1523-UNK 1532-UNK 1542-UNK 1552-UNK 1561-UNK 1575-UNK 1584-UNK 1593-UNK 1607-UNK 1616-UNK  
                              106-UNK  115-UNK  124-UNK  206-UNK  215-UNK  224-UNK  304-UNK  351-UNK  360-UNK  409-UNK  418-UNK  427-UNK  502-UNK  511-UNK  520-UNK  609-UNK  654-UNK  663-UNK  709-UNK  718-UNK  727-UNK  805-UNK  814-UNK  823-UNK  908-UNK  917-UNK 1006-UNK 1015-UNK 1051-UNK 1060-UNK 1108-UNK 1117-UNK 1197-UNK 1206-UNK 1215-UNK 1303-UNK 1312-UNK 1321-UNK 1404-UNK 1413-UNK 1505-UNK 1514-UNK 1524-UNK 1533-UNK 1543-UNK 1553-UNK 1562-UNK 1576-UNK 1585-UNK 1594-UNK 1608-UNK 1617-UNK 
                               107-UNK  116-UNK  125-UNK  207-UNK  216-UNK  225-UNK  305-UNK  352-UNK  401-UNK  410-UNK  419-UNK  428-UNK  503-UNK  512-UNK  601-UNK  610-UNK  655-UNK  664-UNK  710-UNK  719-UNK  728-UNK  806-UNK  815-UNK  824-UNK  909-UNK  918-UNK 1007-UNK 1016-UNK 1052-UNK 1061-UNK 1109-UNK 1118-UNK 1198-UNK 1207-UNK 1216-UNK 1304-UNK 1313-UNK 1322-UNK 1405-UNK 1414-UNK 1506-UNK 1515-UNK 1525-UNK 1535-UNK 1545-UNK 1554-UNK 1563-UNK 1577-UNK 1586-UNK 1595-UNK 1609-UNK 1618-UNK
                                108-UNK  117-UNK  126-UNK  208-UNK  217-UNK  226-UNK  306-UNK  353-UNK  402-UNK  411-UNK  420-UNK  495-UNK  504-UNK  513-UNK  602-UNK  611-UNK  656-UNK  665-UNK  711-UNK  720-UNK  729-UNK  807-UNK  816-UNK  901-UNK  910-UNK  919-UNK 1008-UNK 1017-UNK 1053-UNK 1101-UNK 1110-UNK 1119-UNK 1199-UNK 1208-UNK 1217-UNK 1305-UNK 1314-UNK 1323-UNK 1406-UNK 1415-UNK 1507-UNK 1516-UNK 1526-UNK 1536-UNK 1546-UNK 1555-UNK 1569-UNK 1578-UNK 1587-UNK 1601-UNK 1610-UNK 1619-UNK
                                 109-UNK  118-UNK  127-UNK  209-UNK  218-UNK  227-UNK  307-UNK  354-UNK  403-UNK  412-UNK  421-UNK  496-UNK  505-UNK  514-UNK  603-UNK  612-UNK  657-UNK  666-UNK  712-UNK  721-UNK  730-UNK  808-UNK  817-UNK  902-UNK  911-UNK  920-UNK 1009-UNK 1018-UNK 1054-UNK 1102-UNK 1111-UNK 1120-UNK 1200-UNK 1209-UNK 1218-UNK 1306-UNK 1315-UNK 1324-UNK 1407-UNK 1416-UNK 1508-UNK 1517-UNK 1527-UNK 1537-UNK 1547-UNK 1556-UNK 1570-UNK 1579-UNK 1588-UNK 1602-UNK 1611-UNK 1620-UNK

Chain M from PDB  Type:PROTEIN  Length:391
                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s M   98 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 1423
                            |||||||107|||||||117|||||||204|||||||214|||||||224|||||||306|||||||352|||||||362|||||||402|||||||412|||||||422|||||||502|||||||512|||||||602|||||||612|||||||656|||||||706|||||||716|||||||726|||||||801|||||||811|||||||821|||||||900|||||||910|||||||920||||||1008||||||1018||||||1053||||||1063||||||1107||||||1117||||||1205||||||1215||||||1302||||||1312||||||1322||||||1402||||||1412||||||1422|
                            ||||||106-UNK||115-UNK||201-UNK||210-UNK||219-UNK||228-UNK||309-UNK||354-UNK||363-UNK||402-UNK||411-UNK||420-UNK||499-UNK||508-UNK||517-UNK||606-UNK||615-UNK||658-UNK||707-UNK||716-UNK||725-UNK||734-UNK||808-UNK||817-UNK||826-UNK||904-UNK||913-UNK||922-UNK|1009-UNK|1018-UNK|1052-UNK|1061-UNK|1104-UNK|1113-UNK|1200-UNK|1209-UNK|1218-UNK|1304-UNK|1313-UNK|1322-UNK|1401-UNK|1410-UNK|1419-UNK
                           98-UNK||107-UNK||116-UNK||202-UNK||211-UNK||220-UNK||301-UNK||310-UNK||355-UNK||364-UNK||403-UNK||412-UNK||421-UNK||500-UNK||509-UNK||518-UNK||607-UNK||650-UNK||659-UNK||708-UNK||717-UNK||726-UNK||800-UNK||809-UNK||818-UNK||827-UNK||905-UNK||914-UNK||923-UNK|1010-UNK|1019-UNK|1053-UNK|1062-UNK|1105-UNK|1114-UNK|1201-UNK|1210-UNK|1219-UNK|1305-UNK|1314-UNK|1323-UNK|1402-UNK|1411-UNK|1420-UNK
                            99-UNK||108-UNK||117-UNK||203-UNK||212-UNK||221-UNK||302-UNK||311-UNK||356-UNK||365-UNK||404-UNK||413-UNK||422-UNK||501-UNK||510-UNK||519-UNK||608-UNK||651-UNK||660-UNK||709-UNK||718-UNK||727-UNK||801-UNK||810-UNK||819-UNK||828-UNK||906-UNK||915-UNK|1002-UNK|1011-UNK|1020-UNK|1054-UNK|1063-UNK|1106-UNK|1115-UNK|1202-UNK|1211-UNK|1220-UNK|1306-UNK|1315-UNK|1324-UNK|1403-UNK|1412-UNK|1421-UNK
                            100-UNK| 109-UNK| 118-UNK| 204-UNK| 213-UNK| 222-UNK| 303-UNK| 312-UNK| 357-UNK| 366-UNK| 405-UNK| 414-UNK| 423-UNK| 502-UNK| 511-UNK| 520-UNK| 609-UNK| 652-UNK| 661-UNK| 710-UNK| 719-UNK| 728-UNK| 802-UNK| 811-UNK| 820-UNK| 829-UNK| 907-UNK| 916-UNK|1003-UNK|1012-UNK|1021-UNK|1055-UNK|1064-UNK|1107-UNK|1116-UNK|1203-UNK|1212-UNK|1221-UNK|1307-UNK|1316-UNK|1325-UNK|1404-UNK|1413-UNK|1422-UNK
                             101-UNK  110-UNK  119-UNK  205-UNK  214-UNK  223-UNK  304-UNK  313-UNK  358-UNK  367-UNK  406-UNK  415-UNK  424-UNK  503-UNK  512-UNK  601-UNK  610-UNK  653-UNK  662-UNK  711-UNK  720-UNK  729-UNK  803-UNK  812-UNK  821-UNK  899-UNK  908-UNK  917-UNK 1004-UNK 1013-UNK 1022-UNK 1056-UNK 1065-UNK 1108-UNK 1117-UNK 1204-UNK 1213-UNK 1222-UNK 1308-UNK 1317-UNK 1326-UNK 1405-UNK 1414-UNK 1423-UNK
                              102-UNK  111-UNK  120-UNK  206-UNK  215-UNK  224-UNK  305-UNK  350-UNK  359-UNK  398-UNK  407-UNK  416-UNK  495-UNK  504-UNK  513-UNK  602-UNK  611-UNK  654-UNK  663-UNK  712-UNK  721-UNK  730-UNK  804-UNK  813-UNK  822-UNK  900-UNK  909-UNK  918-UNK 1005-UNK 1014-UNK 1023-UNK 1057-UNK 1100-UNK 1109-UNK 1118-UNK 1205-UNK 1214-UNK 1300-UNK 1309-UNK 1318-UNK 1327-UNK 1406-UNK 1415-UNK    
                               103-UNK  112-UNK  121-UNK  207-UNK  216-UNK  225-UNK  306-UNK  351-UNK  360-UNK  399-UNK  408-UNK  417-UNK  496-UNK  505-UNK  514-UNK  603-UNK  612-UNK  655-UNK  704-UNK  713-UNK  722-UNK  731-UNK  805-UNK  814-UNK  823-UNK  901-UNK  910-UNK  919-UNK 1006-UNK 1015-UNK 1024-UNK 1058-UNK 1101-UNK 1110-UNK 1119-UNK 1206-UNK 1215-UNK 1301-UNK 1310-UNK 1319-UNK 1328-UNK 1407-UNK 1416-UNK   
                                104-UNK  113-UNK  122-UNK  208-UNK  217-UNK  226-UNK  307-UNK  352-UNK  361-UNK  400-UNK  409-UNK  418-UNK  497-UNK  506-UNK  515-UNK  604-UNK  613-UNK  656-UNK  705-UNK  714-UNK  723-UNK  732-UNK  806-UNK  815-UNK  824-UNK  902-UNK  911-UNK  920-UNK 1007-UNK 1016-UNK 1050-UNK 1059-UNK 1102-UNK 1111-UNK 1120-UNK 1207-UNK 1216-UNK 1302-UNK 1311-UNK 1320-UNK 1399-UNK 1408-UNK 1417-UNK  
                                 105-UNK  114-UNK  123-UNK  209-UNK  218-UNK  227-UNK  308-UNK  353-UNK  362-UNK  401-UNK  410-UNK  419-UNK  498-UNK  507-UNK  516-UNK  605-UNK  614-UNK  657-UNK  706-UNK  715-UNK  724-UNK  733-UNK  807-UNK  816-UNK  825-UNK  903-UNK  912-UNK  921-UNK 1008-UNK 1017-UNK 1051-UNK 1060-UNK 1103-UNK 1112-UNK 1121-UNK 1208-UNK 1217-UNK 1303-UNK 1312-UNK 1321-UNK 1400-UNK 1409-UNK 1418-UNK 

Chain N from PDB  Type:PROTEIN  Length:378
                                                                                                                                                                                                                                                                                                                                                                                                                           
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3m9s N   92 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx 1428
                            |||||||101|||||||111|||||||121|||||||211|||||||221|||||||305|||||||351|||||||361|||||||399|||||||409|||||||419|||||||501|||||||511|||||||521|||||||607|||||||651|||||||661|||||||705|||||||715|||||||802|||||||812|||||||822|||||||911|||||||921||||||1008||||||1018||||||1055||||||1101||||||1111||||||1121||||||1208||||||1218||||||1300||||||1310||||||1320||||||1410||||||1420||||||||
                            ||||||100-UNK||109-UNK||118-UNK||207-UNK||216-UNK||225-UNK||308-UNK||353-UNK||362-UNK||399-UNK||408-UNK||417-UNK||426-UNK||507-UNK||516-UNK||601-UNK||610-UNK||653-UNK||662-UNK||705-UNK||714-UNK||723-UNK||809-UNK||818-UNK||906-UNK||915-UNK|1001-UNK|1010-UNK|1019-UNK|1055-UNK|1100-UNK|1109-UNK|1118-UNK|1204-UNK|1213-UNK|1222-UNK|1303-UNK|1312-UNK|1401-UNK|1410-UNK|1419-UNK|1428-UNK
                           92-UNK||101-UNK||110-UNK||119-UNK||208-UNK||217-UNK||226-UNK||309-UNK||354-UNK||363-UNK||400-UNK||409-UNK||418-UNK||427-UNK||508-UNK||517-UNK||602-UNK||611-UNK||654-UNK||663-UNK||706-UNK||715-UNK||801-UNK||810-UNK||819-UNK||907-UNK||916-UNK|1002-UNK|1011-UNK|1020-UNK|1056-UNK|1101-UNK|1110-UNK|1119-UNK|1205-UNK|1214-UNK|1295-UNK|1304-UNK|1313-UNK|1402-UNK|1411-UNK|1420-UNK||| 
                            93-UNK||102-UNK||111-UNK||120-UNK||209-UNK||218-UNK||301-UNK||310-UNK||355-UNK||364-UNK||401-UNK||410-UNK||419-UNK||428-UNK||509-UNK||518-UNK||603-UNK||612-UNK||655-UNK||664-UNK||707-UNK||716-UNK||802-UNK||811-UNK||820-UNK||908-UNK||917-UNK|1003-UNK|1012-UNK|1021-UNK|1057-UNK|1102-UNK|1111-UNK|1120-UNK|1206-UNK|1215-UNK|1296-UNK|1305-UNK|1314-UNK|1403-UNK|1412-UNK|1421-UNK|| 
                             94-UNK| 103-UNK| 112-UNK| 121-UNK| 210-UNK| 219-UNK| 302-UNK| 311-UNK| 356-UNK| 365-UNK| 402-UNK| 411-UNK| 420-UNK| 501-UNK| 510-UNK| 519-UNK| 604-UNK| 613-UNK| 656-UNK| 665-UNK| 708-UNK| 717-UNK| 803-UNK| 812-UNK| 821-UNK| 909-UNK| 918-UNK|1004-UNK|1013-UNK|1022-UNK|1058-UNK|1103-UNK|1112-UNK|1121-UNK|1207-UNK|1216-UNK|1297-UNK|1306-UNK|1315-UNK|1404-UNK|1413-UNK|1422-UNK| 
                              95-UNK  104-UNK  113-UNK  202-UNK  211-UNK  220-UNK  303-UNK  312-UNK  357-UNK  366-UNK  403-UNK  412-UNK  421-UNK  502-UNK  511-UNK  520-UNK  605-UNK  614-UNK  657-UNK  700-UNK  709-UNK  718-UNK  804-UNK  813-UNK  822-UNK  910-UNK  919-UNK 1005-UNK 1014-UNK 1050-UNK 1059-UNK 1104-UNK 1113-UNK 1122-UNK 1208-UNK 1217-UNK 1298-UNK 1307-UNK 1316-UNK 1405-UNK 1414-UNK 1423-UNK 
                               96-UNK  105-UNK  114-UNK  203-UNK  212-UNK  221-UNK  304-UNK  313-UNK  358-UNK  395-UNK  404-UNK  413-UNK  422-UNK  503-UNK  512-UNK  521-UNK  606-UNK  615-UNK  658-UNK  701-UNK  710-UNK  719-UNK  805-UNK  814-UNK  823-UNK  911-UNK  920-UNK 1006-UNK 1015-UNK 1051-UNK 1096-UNK 1105-UNK 1114-UNK 1200-UNK 1209-UNK 1218-UNK 1299-UNK 1308-UNK 1317-UNK 1406-UNK 1415-UNK 1424-UNK
                                97-UNK  106-UNK  115-UNK  204-UNK  213-UNK  222-UNK  305-UNK  350-UNK  359-UNK  396-UNK  405-UNK  414-UNK  423-UNK  504-UNK  513-UNK  522-UNK  607-UNK  650-UNK  659-UNK  702-UNK  711-UNK  720-UNK  806-UNK  815-UNK  903-UNK  912-UNK  921-UNK 1007-UNK 1016-UNK 1052-UNK 1097-UNK 1106-UNK 1115-UNK 1201-UNK 1210-UNK 1219-UNK 1300-UNK 1309-UNK 1318-UNK 1407-UNK 1416-UNK 1425-UNK
                                 98-UNK  107-UNK  116-UNK  205-UNK  214-UNK  223-UNK  306-UNK  351-UNK  360-UNK  397-UNK  406-UNK  415-UNK  424-UNK  505-UNK  514-UNK  523-UNK  608-UNK  651-UNK  660-UNK  703-UNK  712-UNK  721-UNK  807-UNK  816-UNK  904-UNK  913-UNK  922-UNK 1008-UNK 1017-UNK 1053-UNK 1098-UNK 1107-UNK 1116-UNK 1202-UNK 1211-UNK 1220-UNK 1301-UNK 1310-UNK 1319-UNK 1408-UNK 1417-UNK 1426-UNK
                                  99-UNK  108-UNK  117-UNK  206-UNK  215-UNK  224-UNK  307-UNK  352-UNK  361-UNK  398-UNK  407-UNK  416-UNK  425-UNK  506-UNK  515-UNK  524-UNK  609-UNK  652-UNK  661-UNK  704-UNK  713-UNK  722-UNK  808-UNK  817-UNK  905-UNK  914-UNK  923-UNK 1009-UNK 1018-UNK 1054-UNK 1099-UNK 1108-UNK 1117-UNK 1203-UNK 1212-UNK 1221-UNK 1302-UNK 1311-UNK 1320-UNK 1409-UNK 1418-UNK 1427-UNK

Chain O from PDB  Type:PROTEIN  Length:469
                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                      
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhh..hhhhhhhhh..hhhhhhhhhhhhhhhhhhh.hhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh..hhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.hhhh..hhhhh......hhhhhh..hhhhhhhh..hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh...hhhhhhh..hhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3m9s O  102 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx