3K77 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Biological Unit 5 (Jmol Viewer)

Biological Unit 6 (Jmol Viewer)

Biological Unit 7 (Jmol Viewer)

Biological Unit 8 (Jmol Viewer)

Title :   X-RAY CRYSTAL STRUCTURE OF XRCC1

Authors :   M. J. Cuneo, R. E. London

Date :   12 Oct 09 (Deposition) - 28 Apr 10 (Release) - 28 Apr 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.60

Chains :   Asym. Unit : A,B,C,D,E,F,G,H
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)
Biol. Unit 5: E  (1x)
Biol. Unit 6: F  (1x)
Biol. Unit 7: G  (1x)
Biol. Unit 8: H  (1x)

Keywords :   Xrcc1, Base Excision Repair, Scaffolding Protein, Dna Damage, Dna Repair, Nucleus, Phosphoprotein, Polymorphism, Ubl Conjugation, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Cuneo, R. E. London
Oxidation State Of The Xrcc1 N-Terminal Domain Regulates Dna Polymerase Beta Binding Affinity.
Proc. Natl. Acad. Sci. Usa V. 107 6805 2010
PubMed-ID: 20351257 | Reference-DOI: 10.1073/PNAS.0914077107

Molecule 1 - DNA REPAIR PROTEIN XRCC1
	Chains	:	A, B, C, D, E, F, G, H
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET21A
	Expression System Strain	:	BL21-DE3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	XRCC1
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Strain	:	HUMAN
	Synonym	:	X-RAY REPAIR CROSS-COMPLEMENTING PROTEIN 1

		1	2	3	4	5	6	7	8
Asymmetric Unit	:	A	B	C	D	E	F	G	H
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D
Biological Unit 5 (1x)	:					E
Biological Unit 6 (1x)	:						F
Biological Unit 7 (1x)	:							G
Biological Unit 8 (1x)	:								H

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3K77)

(no "Site" information available for 3K77)

(no "SS Bond" information available for 3K77)

(no "Cis Peptide Bond" information available for 3K77)

Asymmetric Unit (4, 32)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	A/B/C/D/E/F/G/H	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	A/B/C/D/E/F/G/H	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	A/B/C/D/E/F/G/H	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	A/B/C/D/E/F/G/H	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	A	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	A	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	A	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	A	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	B	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	B	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	B	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	B	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	C	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	C	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	C	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	C	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	D	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	D	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	D	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	D	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 5 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	E	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	E	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	E	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	E	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 6 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	F	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	F	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	F	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	F	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 7 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	G	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	G	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	G	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	G	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 8 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_014773	R	7	L	XRCC1_HUMAN	Polymorphism	2307186	H	R	7	L
2	UniProt	VAR_014774	V	10	M	XRCC1_HUMAN	Polymorphism	2307171	H	V	10	M
3	UniProt	VAR_016168	V	72	A	XRCC1_HUMAN	Polymorphism	25496	H	V	72	A
4	UniProt	VAR_029228	R	107	H	XRCC1_HUMAN	Polymorphism	2228487	H	R	107	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 3K77)

Asymmetric Unit (5, 40)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000262887	1	ENSE00001213791	chr19:44079730-44079560	171	XRCC1_HUMAN	1-17	17	8	A:2-17 B:2-17 C:2-17 D:2-17 E:2-17 F:2-17 G:2-17 H:2-17	16 16 16 16 16 16 16 16
1.2	ENST00000262887	2	ENSE00000897653	chr19:44079154-44079062	93	XRCC1_HUMAN	18-48	31	8	A:18-48 B:18-48 C:18-48 D:18-48 E:18-48 F:18-48 G:18-48 H:18-48	31 31 31 31 31 31 31 31
1.3	ENST00000262887	3	ENSE00000710723	chr19:44065172-44065062	111	XRCC1_HUMAN	49-85	37	8	A:49-85 B:49-85 C:49-85 D:49-85 E:49-85 F:49-85 G:49-85 H:49-85	37 37 37 37 37 37 37 37
1.4	ENST00000262887	4	ENSE00000710692	chr19:44058956-44058798	159	XRCC1_HUMAN	86-138	53	8	A:86-138 B:86-138 C:86-138 D:86-138 E:86-138 F:86-138 G:86-138 H:86-138	53 53 53 53 53 53 53 53
1.5	ENST00000262887	5	ENSE00000710666	chr19:44057835-44057761	75	XRCC1_HUMAN	139-163	25	8	A:139-153 B:139-153 C:139-153 D:139-153 E:139-153 F:139-153 G:139-153 H:139-153	15 15 15 15 15 15 15 15
1.6	ENST00000262887	6	ENSE00000847423	chr19:44057664-44057553	112	XRCC1_HUMAN	164-201	38	0	-	-
1.7	ENST00000262887	7	ENSE00000710635	chr19:44057243-44057134	110	XRCC1_HUMAN	201-237	37	0	-	-
1.8	ENST00000262887	8	ENSE00000710618	chr19:44057060-44056949	112	XRCC1_HUMAN	238-275	38	0	-	-
1.9	ENST00000262887	9	ENSE00000710592	chr19:44056427-44056169	259	XRCC1_HUMAN	275-361	87	0	-	-
1.10b	ENST00000262887	10b	ENSE00000710568	chr19:44055839-44055723	117	XRCC1_HUMAN	361-400	40	0	-	-
1.11a	ENST00000262887	11a	ENSE00000710543	chr19:44051129-44051036	94	XRCC1_HUMAN	400-431	32	0	-	-
1.13	ENST00000262887	13	ENSE00001674062	chr19:44050879-44050747	133	XRCC1_HUMAN	432-476	45	0	-	-
1.14	ENST00000262887	14	ENSE00001737651	chr19:44050258-44050204	55	XRCC1_HUMAN	476-494	19	0	-	-
1.15	ENST00000262887	15	ENSE00001695855	chr19:44050109-44049970	140	XRCC1_HUMAN	494-541	48	0	-	-
1.16	ENST00000262887	16	ENSE00001614503	chr19:44048386-44048296	91	XRCC1_HUMAN	541-571	31	0	-	-
1.17	ENST00000262887	17	ENSE00001797037	chr19:44047839-44047764	76	XRCC1_HUMAN	571-596	26	0	-	-
1.18	ENST00000262887	18	ENSE00001669136	chr19:44047657-44047464	194	XRCC1_HUMAN	597-633	37	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77a_ A: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77A00 A:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: A:18-48         Exon 1.3  PDB: A:49-85 UniProt: 49-85Exon 1.4  PDB: A:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 A   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain B from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77b_ B: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77B00 B:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: B:18-48         Exon 1.3  PDB: B:49-85 UniProt: 49-85Exon 1.4  PDB: B:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 B   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain C from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77c_ C: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77C00 C:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: C:18-48         Exon 1.3  PDB: C:49-85 UniProt: 49-85Exon 1.4  PDB: C:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 C   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain D from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77d_ D: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77D00 D:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: D:18-48         Exon 1.3  PDB: D:49-85 UniProt: 49-85Exon 1.4  PDB: D:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 D   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain E from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77e_ E: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77E00 E:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: E:18-48         Exon 1.3  PDB: E:49-85 UniProt: 49-85Exon 1.4  PDB: E:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 E   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain F from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77f_ F: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77F00 F:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: F:18-48         Exon 1.3  PDB: F:49-85 UniProt: 49-85Exon 1.4  PDB: F:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 F   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain G from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77g_ G: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77G00 G:2-153 Galactose-binding domain-like                                                                                                            CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: G:18-48         Exon 1.3  PDB: G:49-85 UniProt: 49-85Exon 1.4  PDB: G:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 G   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Chain H from PDB  Type:PROTEIN  Length:152
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:152
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151  
          XRCC1_HUMAN     2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
               SCOP domains d3k77h_ H: N-terminal domain of xrcc1                                                                                                                    SCOP domains
               CATH domains 3k77H00 H:2-153 Galactose-binding domain-like                                                                                                            CATH domains
           Pfam domains (1) XRCC1_N-3k77H01 H:2-151                                                                                                                               -- Pfam domains (1)
           Pfam domains (2) XRCC1_N-3k77H02 H:2-151                                                                                                                               -- Pfam domains (2)
           Pfam domains (3) XRCC1_N-3k77H03 H:2-151                                                                                                                               -- Pfam domains (3)
           Pfam domains (4) XRCC1_N-3k77H04 H:2-151                                                                                                                               -- Pfam domains (4)
           Pfam domains (5) XRCC1_N-3k77H05 H:2-151                                                                                                                               -- Pfam domains (5)
           Pfam domains (6) XRCC1_N-3k77H06 H:2-151                                                                                                                               -- Pfam domains (6)
           Pfam domains (7) XRCC1_N-3k77H07 H:2-151                                                                                                                               -- Pfam domains (7)
           Pfam domains (8) XRCC1_N-3k77H08 H:2-151                                                                                                                               -- Pfam domains (8)
         Sec.struct. author ....eeeeeee.......hhhhhhhhhhh..ee.......eeeeeeeeeeee...eeeeeee...eeeeeee......hhhhheeeeeeee..hhhhhhhh.....eeee.....hhhhhhh.eeeeeeeee.........eeeeeeee... Sec.struct. author
                 SAPs(SNPs) -----L--M-------------------------------------------------------------A----------------------------------H---------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1        Exon 1.2  PDB: H:18-48         Exon 1.3  PDB: H:49-85 UniProt: 49-85Exon 1.4  PDB: H:86-138 UniProt: 86-138              Exon 1.5        Transcript 1
                 3k77 H   2 PEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDIGNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAAAEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPP 153
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Galactose-binding domain-like (314)

Superfamily: Galactose-binding domain-like (314)

Family: N-terminal domain of xrcc1 (5)

Protein domain: N-terminal domain of xrcc1 (5)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d3k77a_	A:
1b	d3k77b_	B:
1c	d3k77c_	C:
1d	d3k77d_	D:
1e	d3k77e_	E:
1f	d3k77f_	F:
1g	d3k77g_	G:
1h	d3k77h_	H:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Jelly Rolls (1293)

Homologous Superfamily: Galactose-binding domain-like (195)

Human (Homo sapiens) (39)

1a	3k77A00	A:2-153
1b	3k77B00	B:2-153
1c	3k77C00	C:2-153
1d	3k77D00	D:2-153
1e	3k77E00	E:2-153
1f	3k77F00	F:2-153
1g	3k77G00	G:2-153
1h	3k77H00	H:2-153

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: GBD (153)

Family: XRCC1_N (4)

Homo sapiens (Human) (4)

1a	XRCC1_N-3k77H01	H:2-151
1b	XRCC1_N-3k77H02	H:2-151
1c	XRCC1_N-3k77H03	H:2-151
1d	XRCC1_N-3k77H04	H:2-151
1e	XRCC1_N-3k77H05	H:2-151
1f	XRCC1_N-3k77H06	H:2-151
1g	XRCC1_N-3k77H07	H:2-151
1h	XRCC1_N-3k77H08	H:2-151

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F,G,H (XRCC1_HUMAN | P18887)

molecular function
	GO:0003909	DNA ligase activity	Catalysis of the formation of a phosphodiester bond between the 3'-hydroxyl group at the end of one DNA chain and the 5'-phosphate group at the end of another. This reaction requires an energy source such as ATP or NAD+.
	GO:0003684	damaged DNA binding	Interacting selectively and non-covalently with damaged DNA.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006284	base-excision repair	In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
	GO:0006288	base-excision repair, DNA ligation	The ligation by DNA ligase of DNA strands. Ligation occurs after polymerase action to fill the gap left by the action of endonucleases during base-excision repair.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0000724	double-strand break repair via homologous recombination	The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
	GO:0006297	nucleotide-excision repair, DNA gap filling	Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0001666	response to hypoxia	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0000012	single strand break repair	The repair of single strand breaks in DNA. Repair of such breaks is mediated by the same enzyme systems as are used in base excision repair.
	GO:0006283	transcription-coupled nucleotide-excision repair	The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
cellular component
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3k77)

	Sites
(no "Sites" information available for 3k77)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3k77)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]
		Biological Unit 6	[ Jena3D ]
		Biological Unit 7	[ Jena3D ]
		Biological Unit 8	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format \| Biol. Unit 5 PNG format \| Biol. Unit 6 PNG format \| Biol. Unit 7 PNG format \| Biol. Unit 8 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3k77
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	XRCC1_HUMAN \| P18887
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	XRCC1_HUMAN \| P18887
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	XRCC1_HUMAN \| P18887	:	1cdz 1xna 1xnt 2d8m 2w3o 3k75 3lqc 5e6q

1xna	NMR SOLUTION STRUCTURE OF THE SINGLE-STRAND BREAK REPAIR PROTEIN XRCC1-N-TERMINAL DOMAIN
3k75
3k76

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 32)

PROSITE Motifs (0, 0)

Exons (5, 40)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 8)

CATH Domains (1, 8)

Pfam Domains (1, 8)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File