Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  BRCT DOMAIN FROM DNA-REPAIR PROTEIN XRCC1
 
Authors :  X. Zhang, S. Morera, P. Bates, P. Whitehead, A. Coffer, K. Hainbucher, R. Nash, M. Sternberg, T. Lindahl, P. Freemont
Date :  04 Mar 99  (Deposition) - 28 Feb 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A
Keywords :  Brct, Brca1, Xrcc1, Protein-Protein Interaction, Dna Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  X. Zhang, S. Morera, P. A. Bates, P. C. Whitehead, A. I. Coffer, K. Hainbucher, R. A. Nash, M. J. Sternberg, T. Lindahl, P. S. Freemont
Structure Of An Xrcc1 Brct Domain: A New Protein-Protein Interaction Module.
Embo J. V. 17 6404 1998
PubMed-ID: 9799248  |  Reference-DOI: 10.1093/EMBOJ/17.21.6404
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (DNA-REPAIR PROTEIN XRCC1)
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: B834
    Expression System Taxid: 562
    Fragment: C-TERMINAL BRCT DOMAIN
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1CDZ)

(-) Sites  (0, 0)

(no "Site" information available for 1CDZ)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1CDZ)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1CDZ)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (4, 4)

Asymmetric/Biological Unit (4, 4)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_014780R559QXRCC1_HUMANPolymorphism2307167AR22Q
2UniProtVAR_014781R560WXRCC1_HUMANPolymorphism2307166AR23W
3UniProtVAR_014782N576SXRCC1_HUMANPolymorphism2307177AY39S
4UniProtVAR_061727N576YXRCC1_HUMANPolymorphism2682557AY39Y
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (1, 1)

Asymmetric/Biological Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BRCTPS50172 BRCT domain profile.XRCC1_HUMAN315-403
538-629		  1-
A:1-92

(-) Exons   (4, 4)

Asymmetric/Biological Unit (4, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002628871ENSE00001213791chr19:44079730-44079560171XRCC1_HUMAN1-17170--
1.2ENST000002628872ENSE00000897653chr19:44079154-4407906293XRCC1_HUMAN18-48310--
1.3ENST000002628873ENSE00000710723chr19:44065172-44065062111XRCC1_HUMAN49-85370--
1.4ENST000002628874ENSE00000710692chr19:44058956-44058798159XRCC1_HUMAN86-138530--
1.5ENST000002628875ENSE00000710666chr19:44057835-4405776175XRCC1_HUMAN139-163250--
1.6ENST000002628876ENSE00000847423chr19:44057664-44057553112XRCC1_HUMAN164-201380--
1.7ENST000002628877ENSE00000710635chr19:44057243-44057134110XRCC1_HUMAN201-237370--
1.8ENST000002628878ENSE00000710618chr19:44057060-44056949112XRCC1_HUMAN238-275380--
1.9ENST000002628879ENSE00000710592chr19:44056427-44056169259XRCC1_HUMAN275-361870--
1.10bENST0000026288710bENSE00000710568chr19:44055839-44055723117XRCC1_HUMAN361-400400--
1.11aENST0000026288711aENSE00000710543chr19:44051129-4405103694XRCC1_HUMAN400-431320--
1.13ENST0000026288713ENSE00001674062chr19:44050879-44050747133XRCC1_HUMAN432-476450--
1.14ENST0000026288714ENSE00001737651chr19:44050258-4405020455XRCC1_HUMAN476-494190--
1.15ENST0000026288715ENSE00001695855chr19:44050109-44049970140XRCC1_HUMAN494-541481A:1-44
1.16ENST0000026288716ENSE00001614503chr19:44048386-4404829691XRCC1_HUMAN541-571311A:4-3431
1.17ENST0000026288717ENSE00001797037chr19:44047839-4404776476XRCC1_HUMAN571-596261A:34-5926
1.18ENST0000026288718ENSE00001669136chr19:44047657-44047464194XRCC1_HUMAN597-633371A:60-9637

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:96
 aligned with XRCC1_HUMAN | P18887 from UniProtKB/Swiss-Prot  Length:633

    Alignment length:96
                                   547       557       567       577       587       597       607       617       627      
          XRCC1_HUMAN   538 ELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA 633
               SCOP domains d1cdza_ A: DNA-repair protein XRCC1                                                              SCOP domains
               CATH domains 1cdzA00 A:1-96  [code=3.40.50.10190, no name defined]                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..........eee......hhhhhhhhhhhhh.............eee......hhhhhhhhh....eee.hhhhhhhhhh.....hhhh...... Sec.struct. author
             SAPs(SNPs) (1) ---------------------QW---------------S--------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) --------------------------------------Y--------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE BRCT  PDB: A:1-92 UniProt: 538-629                                                          ---- PROSITE
           Transcript 1 (1) 1.15-----------------------------Exon 1.17  PDB: A:34-59   Exon 1.18  PDB: A:60-96               Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.16  PDB: A:4-34         -------------------------------------------------------------- Transcript 1 (2)
                 1cdz A   1 ELPDFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDPSFEEALMDNPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA  96
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1CDZ)

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (XRCC1_HUMAN | P18887)
molecular function
    GO:0003909    DNA ligase activity    Catalysis of the formation of a phosphodiester bond between the 3'-hydroxyl group at the end of one DNA chain and the 5'-phosphate group at the end of another. This reaction requires an energy source such as ATP or NAD+.
    GO:0003684    damaged DNA binding    Interacting selectively and non-covalently with damaged DNA.
    GO:0019899    enzyme binding    Interacting selectively and non-covalently with any enzyme.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006284    base-excision repair    In base excision repair, an altered base is removed by a DNA glycosylase enzyme, followed by excision of the resulting sugar phosphate. The small gap left in the DNA helix is filled in by the sequential action of DNA polymerase and DNA ligase.
    GO:0006288    base-excision repair, DNA ligation    The ligation by DNA ligase of DNA strands. Ligation occurs after polymerase action to fill the gap left by the action of endonucleases during base-excision repair.
    GO:0006974    cellular response to DNA damage stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
    GO:0000724    double-strand break repair via homologous recombination    The error-free repair of a double-strand break in DNA in which the broken DNA molecule is repaired using homologous sequences. A strand in the broken DNA searches for a homologous region in an intact chromosome to serve as the template for DNA synthesis. The restoration of two intact DNA molecules results in the exchange, reciprocal or nonreciprocal, of genetic material between the intact DNA molecule and the broken DNA molecule.
    GO:0006297    nucleotide-excision repair, DNA gap filling    Repair of the gap in the DNA helix by DNA polymerase and DNA ligase after the portion of the strand containing the lesion has been removed by pyrimidine-dimer repair enzymes.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0001666    response to hypoxia    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating lowered oxygen tension. Hypoxia, defined as a decline in O2 levels below normoxic levels of 20.8 - 20.95%, results in metabolic adaptation at both the cellular and organismal level.
    GO:0010033    response to organic substance    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
    GO:0000012    single strand break repair    The repair of single strand breaks in DNA. Repair of such breaks is mediated by the same enzyme systems as are used in base excision repair.
    GO:0006283    transcription-coupled nucleotide-excision repair    The nucleotide-excision repair process that carries out preferential repair of DNA lesions on the actively transcribed strand of the DNA duplex. In addition, the transcription-coupled nucleotide-excision repair pathway is required for the recognition and repair of a small subset of lesions that are not recognized by the global genome nucleotide excision repair pathway.
cellular component
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1cdz)
 
  Sites
(no "Sites" information available for 1cdz)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1cdz)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1cdz
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  XRCC1_HUMAN | P18887
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  XRCC1_HUMAN | P18887
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        XRCC1_HUMAN | P18887: 1xna 1xnt 2d8m 2w3o 3k75 3k77 3lqc 5e6q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1CDZ)