|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 2)
|
(no "Site" information available for 3I90) |
(no "SS Bond" information available for 3I90) |
(no "Cis Peptide Bond" information available for 3I90) |
(no "SAP(SNP)/Variant" information available for 3I90) |
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 3I90) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:50 aligned with CBX6_HUMAN | O95503 from UniProtKB/Swiss-Prot Length:412 Alignment length:50 18 28 38 48 58 CBX6_HUMAN 9 RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE 58 SCOP domains d3i90a_ A: automated matches SCOP domains CATH domains 3i90A00 A:9-58 [code=2.40.50.40, no name defined] CATH domains Pfam domains -------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE (1) --CHROMO_2 PDB: A:11-58 UniProt: 11-69 PROSITE (1) PROSITE (2) -------------------CHROMO_1 PDB: A:28-4---------- PROSITE (2) Transcript -------------------------------------------------- Transcript 3i90 A 9 RVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFE 58 18 28 38 48 58 Chain B from PDB Type:PROTEIN Length:50 aligned with CBX6_HUMAN | O95503 from UniProtKB/Swiss-Prot Length:412 Alignment length:50 19 29 39 49 59 CBX6_HUMAN 10 VFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQ 59 SCOP domains d3i90b_ B: automated matches SCOP domains CATH domains -------------------------------------------------- CATH domains Pfam domains -------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------- SAPs(SNPs) PROSITE (1) -CHROMO_2 PDB: B:11-59 UniProt: 11-69 PROSITE (1) PROSITE (2) ------------------CHROMO_1 PDB: B:28-4----------- PROSITE (2) Transcript -------------------------------------------------- Transcript 3i90 B 10 VFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAFEQ 59 19 29 39 49 59 Chain C from PDB Type:PROTEIN Length:11 SCOP domains ----------- SCOP domains CATH domains ----------- CATH domains Pfam domains ----------- Pfam domains SAPs(SNPs) ----------- SAPs(SNPs) PROSITE ----------- PROSITE Transcript ----------- Transcript 3i90 C 19 QLATKAARkSA 29 28 27-M3L Chain D from PDB Type:PROTEIN Length:10 SCOP domains ---------- SCOP domains CATH domains ---------- CATH domains Pfam domains ---------- Pfam domains SAPs(SNPs) ---------- SAPs(SNPs) PROSITE ---------- PROSITE Transcript ---------- Transcript 3i90 D 19 QLATKAARkS 28 28 27-M3L
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3I90) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CBX6_HUMAN | O95503)
|
|
|
|
|
|
|