3HDZ - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   IDENTIFICATION, SYNTHESIS, AND SAR OF AMINO SUBSTITUTED PYRIDO[3, 2B]PRYAZIONES AS POTENT AND SELECTIVE PDE5 INHIBITORS

Authors :   J. W. Cubbage, D. G. Brown, E. J. Jacobsen, J. K. Walker, R. O. Hughes

Date :   07 May 09 (Deposition) - 07 Jul 09 (Release) - 21 Jun 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Pde5, Pde-5, Inhibition, Alternative Splicing, Camp, Hydrolase, Phosphoprotein, Polymorphism Allosteric Enzyme, Cgmp, Cgmp-Binding, Magnesium, Metal-Binding, Nucleotide-Binding, Zinc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   D. R. Owen, J. K. Walker, E. Jon Jacobsen, J. N. Freskos, R. O. Hughes, D. L. Brown, A. S. Bell, D. G. Brown, C. Phillips, B. V. Mischke, J. M. Molyneaux, Y. M. Fobian, S. E. Heasley, J. B. Moon, W. C. Stallings D. Joseph Rogier, D. N. Fox, M. J. Palmer, T. Ringer, M. Rodriquez-Lens, J. W. Cubbage, R. M. Blevis-Bal, A. G. Benson, B. A. Acker, T. M. Maddux, M. B. Tollefson, B. R. Bond, A. Macinnes, Y. Yu
Identification, Synthesis And Sar Of Amino Substituted Pyrido[3, 2B]Pyrazinones As Potent And Selective Pde5 Inhibitors.
Bioorg. Med. Chem. Lett. 2009
PubMed-ID: 19540112 | Reference-DOI: 10.1016/J.BMCL.2009.06.012

Molecule 1 - CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE,CAMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 4A,CGMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE
	Chains	:	A
	EC Number	:	3.1.4.35, 3.1.4.53
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Plasmid	:	FASTBAC
	Expression System Strain	:	HIGH5
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	PDE4A RESIDUES 456-480, PDE5A RESIDUES 536-657 682-858
	Gene	:	PDE5A, PDE5, PDE4A, DPDE2
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Other Details	:	RESIDUES 658-682 FROM PDE4
	Synonym	:	CGMP-BINDING CGMP-SPECIFIC PHOSPHODIESTERASE,CGB-PDE,DPDE2, PDE46,CGMP-BINDING CGMP-SPECIFIC PHOSPHODIESTERASE,CGB-PDE

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (3, 3)

No.	Name	Count	Type	Full Name
1	MG	1	Ligand/Ion	MAGNESIUM ION
2	PD6	1	Ligand/Ion	5-AMINO-1-BUTYL-7-PHENYL-1,6-NAPHTHYRIDIN-4(1H)-ONE
3	ZN	1	Ligand/Ion	ZINC ION

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:258 , HOH A:376 , ALA A:767 , LEU A:804 , MET A:816 , GLN A:817 , PHE A:820	BINDING SITE FOR RESIDUE PD6 A 400
2	AC2	SOFTWARE	HOH A:5 , HOH A:27 , HIS A:617 , HIS A:653 , ASP A:654 , ASP A:764 , MG A:865	BINDING SITE FOR RESIDUE ZN A 864
3	AC3	SOFTWARE	HOH A:3 , HOH A:5 , HOH A:8 , HOH A:383 , HOH A:384 , ASP A:654 , ZN A:864	BINDING SITE FOR RESIDUE MG A 865

(no "SS Bond" information available for 3HDZ)

(no "Cis Peptide Bond" information available for 3HDZ)

(no "SAP(SNP)/Variant" information available for 3HDZ)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4A_HUMAN	473-484	1	A:653-664
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE5A_HUMAN	653-664	1	A:653-662

Asymmetric/Biological Unit (11, 11)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000354960	1a	ENSE00001851914	chr4:120550146-120549675	472	PDE5A_HUMAN	1-51	51	0	-	-
1.4	ENST00000354960	4	ENSE00001637089	chr4:120528452-120527864	589	PDE5A_HUMAN	51-247	197	0	-	-
1.5b	ENST00000354960	5b	ENSE00000935544	chr4:120517767-120517678	90	PDE5A_HUMAN	248-277	30	0	-	-
1.6	ENST00000354960	6	ENSE00000970323	chr4:120488299-120488228	72	PDE5A_HUMAN	278-301	24	0	-	-
1.7	ENST00000354960	7	ENSE00000970324	chr4:120486565-120486476	90	PDE5A_HUMAN	302-331	30	0	-	-
1.8b	ENST00000354960	8b	ENSE00000970325	chr4:120484125-120483988	138	PDE5A_HUMAN	332-377	46	0	-	-
1.9	ENST00000354960	9	ENSE00000970326	chr4:120481518-120481451	68	PDE5A_HUMAN	378-400	23	0	-	-
1.10	ENST00000354960	10	ENSE00000970327	chr4:120474901-120474793	109	PDE5A_HUMAN	400-436	37	0	-	-
1.11a	ENST00000354960	11a	ENSE00000970328	chr4:120473792-120473705	88	PDE5A_HUMAN	437-466	30	0	-	-
1.13	ENST00000354960	13	ENSE00000935541	chr4:120463789-120463614	176	PDE5A_HUMAN	466-524	59	0	-	-
1.15b	ENST00000354960	15b	ENSE00000935545	chr4:120460174-120460115	60	PDE5A_HUMAN	525-544	20	1	A:537-544	8
1.18	ENST00000354960	18	ENSE00001016848	chr4:120446850-120446704	147	PDE5A_HUMAN	545-593	49	1	A:545-593	49
1.19b	ENST00000354960	19b	ENSE00001016844	chr4:120442215-120442090	126	PDE5A_HUMAN	594-635	42	1	A:594-635	42
1.20c	ENST00000354960	20c	ENSE00001016846	chr4:120440294-120440200	95	PDE5A_HUMAN	636-667	32	1	A:636-667	32
1.22	ENST00000354960	22	ENSE00001016843	chr4:120432289-120432202	88	PDE5A_HUMAN	667-696	30	1	A:667-696	31
1.23b	ENST00000354960	23b	ENSE00001016840	chr4:120428859-120428759	101	PDE5A_HUMAN	697-730	34	1	A:697-730	34
1.24b	ENST00000354960	24b	ENSE00001016847	chr4:120427087-120427010	78	PDE5A_HUMAN	730-756	27	1	A:730-756	27
1.25	ENST00000354960	25	ENSE00001016842	chr4:120425754-120425691	64	PDE5A_HUMAN	756-777	22	1	A:756-777	22
1.26a	ENST00000354960	26a	ENSE00001016841	chr4:120423810-120423736	75	PDE5A_HUMAN	778-802	25	1	A:778-802	25
1.27a	ENST00000354960	27a	ENSE00001016845	chr4:120422408-120422325	84	PDE5A_HUMAN	803-830	28	1	A:803-830	28
1.28c	ENST00000354960	28c	ENSE00001890486	chr4:120419893-120415550	4344	PDE5A_HUMAN	831-875	45	1	A:831-858	28

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with PDE4A_HUMAN | P27815 from UniProtKB/Swiss-Prot  Length:886

    Alignment length:420
                                                                                                                                                                                                                                                                                                                                                                                              622              638                                              
                                                                                                                                                                                                                                                                                                                                                                                            621 |            637 |                                              
                                   276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616    | |625       635 | |   644       654       664       674       684
         PDE4A_HUMAN    267 NRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEIPSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTDQEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYMLTLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDMVLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLELYRQWTDRIMAEFFQQGDRER-ERGMEISPMCDKHTAS-VEKSQVGFIDYIVHPLWETWADLVHPDAQEILDTLEDNRDWYYSAIR  684
               SCOP domains d3hdza_ A: automated matche                                       s                                                                                                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 3hdzA00 A:537-858 Catalytic                                        domain of c                                                   yclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhh...hhhhhh........---------------------------------------...hhhhhhhhh---------------------------------------------------hhhhhhh........hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....------..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh-hhh..hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PDEASE_I    ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                3hdz A  537 TRELQSLAAAVVPSAQTLKITDFSFSD---------------------------------------FELSDLETALCT---------------------------------------------------IRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHPGVSNQFLINTNSELALMYNDESVLEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFN------LEDPHEKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALT-HVSEDCFPLLDGCRKNRQKWQALAE  858
                                   546       556      |  -         -         -         -      |567       | -         -         -         -         -       576       586       596       606       616       626       636       646       656       666       676     | 685       695       705       715       725       735       745      |749       759       769       779       789       799       809       819       829   | | 838       848       858
                                                    563                                     564        575                                                 576                                                                                                      681A                                                             745    746                                                                                    833 |                        
                                                                                                                                                                                                                                                                                                                                                                                                                                     834

Chain A from PDB  Type:PROTEIN  Length:323
 aligned with PDE5A_HUMAN | O76074 from UniProtKB/Swiss-Prot  Length:875

    Alignment length:323
                                                                                                                                                                         679                                                                                                                                                                                   
                                                                                                                                                                       678 |                                                                                                                                                                                   
                                   546       556       566       576       586       596       606       616       626       636       646       656       666       676 | |   685       695       705       715       725       735       745       755       765       775       785       795       805       815       825       835       845       855   
         PDE5A_HUMAN    537 TRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHRGVNNSYIQRSEHPLAQLYCH-SIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAE  858
               SCOP domains d3hdza_ A: automated matches                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 3hdzA00 A:537-858 Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhh...hhhhhh...........hhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------PDEASE_I    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.15b   Exon 1.18  PDB: A:545-593 UniProt: 545-593       Exon 1.19b  PDB: A:594-635                Exon 1.20c  PDB: A:636-667      ------------------------------Exon 1.23b  PDB: A:697-730        -------------------------Exon 1.25             Exon 1.26a  PDB: A:778-80Exon 1.27a  PDB: A:803-830  Exon 1.28c  PDB: A:831-858   Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------Exon 1.22  PDB: A:667-696      ---------------------------------Exon 1.24b  PDB: A:730-756 ------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                3hdz A  537 TRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIAALSHDLDHPGVSNQFLINTNSELALMYNDESVLEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHEKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNRQKWQALAE  858
                                   546       556       566       576       586       596       606       616       626       636       646       656       666       676     | 685       695       705       715       725       735       745       755       765       775       785       795       805       815       825       835       845       855   
                                                                                                                                                                          681A

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: HD-domain/PDEase-like (204)

Superfamily: HD-domain/PDEase-like (204)

Family: PDEase (118)

Protein domain: automated matches (21)

Human (Homo sapiens) [TaxId: 9606] (21)

d3hdza_

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b (66)

Homologous Superfamily: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b (66)

Homo sapiens. Organism_taxid: 9606. (1)

3hdzA00

A:537-858

(no "Pfam Domain" information available for 3HDZ)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (PDE4A_HUMAN | P27815)

molecular function
	GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	Catalysis of the reaction: adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.
	GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.
	GO:0030552	cAMP binding	Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008081	phosphoric diester hydrolase activity	Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006198	cAMP catabolic process	The chemical reactions and pathways resulting in the breakdown of the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0043949	regulation of cAMP-mediated signaling	Any process which modulates the frequency, rate or extent of cAMP-mediated signaling, a series of molecular signals in which a cell uses cyclic AMP to convert an extracellular signal into a response.
	GO:0010738	regulation of protein kinase A signaling	Any process that modulates the rate, frequency, or extent of protein kinase A signaling. PKA signaling is the series of reactions, mediated by the intracellular serine/threonine kinase protein kinase A, which occurs as a result of a single trigger reaction or compound.
	GO:0007608	sensory perception of smell	The series of events required for an organism to receive an olfactory stimulus, convert it to a molecular signal, and recognize and characterize the signal. Olfaction involves the detection of chemical composition of an organism's ambient medium by chemoreceptors. This is a neurological process.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0042995	cell projection	A prolongation or process extending from a cell, e.g. a flagellum or axon.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0048471	perinuclear region of cytoplasm	Cytoplasm situated near, or occurring around, the nucleus.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0032587	ruffle membrane	The portion of the plasma membrane surrounding a ruffle.

Chain A (PDE5A_HUMAN | O76074)

molecular function
	GO:0047555	3',5'-cyclic-GMP phosphodiesterase activity	Catalysis of the reaction: guanosine 3',5'-cyclic phosphate + H2O = guanosine 5'-phosphate.
	GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.
	GO:0030553	cGMP binding	Interacting selectively and non-covalently with cGMP, the nucleotide cyclic GMP (guanosine 3',5'-cyclophosphate).
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0004112	cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: a nucleoside cyclic phosphate + H2O = a nucleoside phosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0008081	phosphoric diester hydrolase activity	Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
biological process
	GO:0046069	cGMP catabolic process	The chemical reactions and pathways resulting in the breakdown of cyclic GMP, guanosine 3',5'-phosphate.
	GO:0046068	cGMP metabolic process	The chemical reactions and pathways involving cyclic GMP, guanosine 3',5'-phosphate.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0042130	negative regulation of T cell proliferation	Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
	GO:0055118	negative regulation of cardiac muscle contraction	Any process that stops, prevents, or reduces the frequency, rate or extent of cardiac muscle contraction.
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0010613	positive regulation of cardiac muscle hypertrophy	Any process that increases the rate, frequency or extent of the enlargement or overgrowth of all or part of the heart due to an increase in size (not length) of individual cardiac muscle fibers, without cell division.
	GO:0060282	positive regulation of oocyte development	Any process that increases the rate or extent of the process whose specific outcome is the progression of an oocyte over time, from initial commitment of the cell to its specific fate, to the fully functional differentiated cell.
	GO:0030823	regulation of cGMP metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving cGMP.
	GO:0055119	relaxation of cardiac muscle	The process in which the extent of cardiac muscle contraction is reduced.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005575	cellular_component	The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		PD6	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 3hdz)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3hdz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDE4A_HUMAN \| P27815
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PDE4B_HUMAN \| Q07343
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PDE5A_HUMAN \| O76074
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.4.35
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc
	3.1.4.53
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDE4A_HUMAN \| P27815
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PDE4B_HUMAN \| Q07343
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PDE5A_HUMAN \| O76074
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (11, 11)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (58, 75)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File