1RO6 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PDE4B2B COMPLEXED WITH ROLIPRAM (R & S)

Authors :   R. X. Xu, W. J. Rocque, M. H. Lambert, D. E. Vanderwall, R. T. Nolte

Date :   01 Dec 03 (Deposition) - 07 Dec 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Pde, Rolipram, Crystal, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. X. Xu, W. J. Rocque, M. H. Lambert, D. E. Vanderwall, M. A. Luther, R. T. Nolte
Crystal Structures Of The Catalytic Domain Of Phosphodiesterase 4B Complexed With Amp, 8-Br-Amp, And Rolipram.
J. Mol. Biol. V. 337 355 2004
PubMed-ID: 15003452 | Reference-DOI: 10.1016/J.JMB.2004.01.040
(for further references see the PDB file header)

Molecule 1 - CAMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 4B
	Chains	:	A, B
	EC Number	:	3.1.4.17
	Engineered	:	YES
	Expression System	:	UNIDENTIFIED BACULOVIRUS
	Expression System Taxid	:	10469
	Fragment	:	CATALYTIC DOMAIN
	Gene	:	PDE4B
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DPDE4, PDE32, PDE4B2B

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (4, 7)

No.	Name	Count	Type	Full Name
1	ARS	1	Ligand/Ion	ARSENIC
2	MN	2	Ligand/Ion	MANGANESE (II) ION
3	ROL	2	Ligand/Ion	ROLIPRAM
4	ZN	2	Ligand/Ion	ZINC ION

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	ARS	1	Ligand/Ion	ARSENIC
2	MN	-1	Ligand/Ion	MANGANESE (II) ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	ARS	-1	Ligand/Ion	ARSENIC
2	MN	-1	Ligand/Ion	MANGANESE (II) ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (7, 7)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HIS A:238 , HIS A:274 , ASP A:275 , ASP A:392 , ROL A:601 , HOH A:788	BINDING SITE FOR RESIDUE ZN A 529
2	AC2	SOFTWARE	HIS B:238 , HIS B:274 , ASP B:275 , ASP B:392 , ROL B:602 , HOH B:715	BINDING SITE FOR RESIDUE ZN B 529
3	AC3	SOFTWARE	ASP A:275 , ROL A:601 , HOH A:615 , HOH A:618 , HOH A:650 , HOH A:788	BINDING SITE FOR RESIDUE MN A 530
4	AC4	SOFTWARE	HIS B:274 , ASP B:275 , HIS B:307 , THR B:345 , HOH B:620 , HOH B:695 , HOH B:706	BINDING SITE FOR RESIDUE MN B 530
5	AC5	SOFTWARE	CYS A:194	BINDING SITE FOR RESIDUE ARS A 531
6	AC6	SOFTWARE	TYR A:233 , HIS A:234 , MET A:347 , ASP A:392 , LEU A:393 , ASN A:395 , THR A:407 , ILE A:410 , PHE A:414 , SER A:442 , GLN A:443 , PHE A:446 , ZN A:529 , MN A:530 , HOH A:778 , HOH A:788	BINDING SITE FOR RESIDUE ROL A 601
7	AC7	SOFTWARE	TYR B:233 , HIS B:234 , MET B:347 , ASP B:392 , LEU B:393 , ASN B:395 , THR B:407 , ILE B:410 , MET B:411 , PHE B:414 , SER B:442 , GLN B:443 , PHE B:446 , ZN B:529 , HOH B:715 , HOH B:716	BINDING SITE FOR RESIDUE ROL B 602

(no "SS Bond" information available for 1RO6)

Asymmetric Unit

No.	Residues
1	Gln A:463	-	Pro A:464
2	Gln B:463	-	Pro B:464

(no "SAP(SNP)/Variant" information available for 1RO6)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4B_HUMAN	446-457	2	A:274-285 B:274-285

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4B_HUMAN	446-457	1	A:274-285 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4B_HUMAN	446-457	1	- B:274-285

Asymmetric Unit (8, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000341517	2	ENSE00001777645	chr1:66258864-66258931	68	PDE4B_HUMAN	-	0	0	-	-
1.3a	ENST00000341517	3a	ENSE00001454221	chr1:66378928-66379039	112	PDE4B_HUMAN	1-14	14	0	-	-
1.4	ENST00000341517	4	ENSE00001314677	chr1:66384280-66384518	239	PDE4B_HUMAN	15-94	80	0	-	-
1.10c	ENST00000341517	10c	ENSE00001295605	chr1:66713143-66713337	195	PDE4B_HUMAN	94-159	66	0	-	-
1.12	ENST00000341517	12	ENSE00001648425	chr1:66723330-66723366	37	PDE4B_HUMAN	159-171	13	0	-	-
1.13	ENST00000341517	13	ENSE00001301262	chr1:66723476-66723546	71	PDE4B_HUMAN	172-195	24	0	-	-
1.14a	ENST00000341517	14a	ENSE00001328762	chr1:66731721-66731770	50	PDE4B_HUMAN	195-212	18	0	-	-
1.17e	ENST00000341517	17e	ENSE00001765348	chr1:66798191-66798303	113	PDE4B_HUMAN	212-249	38	0	-	-
1.19b	ENST00000341517	19b	ENSE00001321190	chr1:66821210-66821303	94	PDE4B_HUMAN	250-281	32	0	-	-
1.21	ENST00000341517	21	ENSE00001308616	chr1:66827298-66827476	179	PDE4B_HUMAN	281-340	60	2	A:152-168 B:152-168	17 17
1.22e	ENST00000341517	22e	ENSE00001292510	chr1:66828851-66828949	99	PDE4B_HUMAN	341-373	33	2	A:169-201 B:169-201	33 33
1.23b	ENST00000341517	23b	ENSE00001311355	chr1:66829090-66829254	165	PDE4B_HUMAN	374-428	55	2	A:202-256 B:202-256	55 55
1.24	ENST00000341517	24	ENSE00001294554	chr1:66831350-66831449	100	PDE4B_HUMAN	429-462	34	2	A:257-290 B:257-290	34 34
1.25b	ENST00000341517	25b	ENSE00001326709	chr1:66833379-66833533	155	PDE4B_HUMAN	462-513	52	2	A:290-341 B:290-341	52 52
1.26a	ENST00000341517	26a	ENSE00001304431	chr1:66833626-66833748	123	PDE4B_HUMAN	514-554	41	2	A:342-382 B:342-382	41 41
1.27	ENST00000341517	27	ENSE00001597852	chr1:66834470-66834652	183	PDE4B_HUMAN	555-615	61	2	A:383-443 B:383-443	61 61
1.28c	ENST00000341517	28c	ENSE00002180148	chr1:66837996-66839187	1192	PDE4B_HUMAN	616-736	121	2	A:444-495 B:444-495	52 52

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:344
 aligned with PDE4B_HUMAN | Q07343 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:344
                                   333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663    
          PDE4B_HUMAN   324 SISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQ 667
               SCOP domains d1ro6a_ A: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1ro6A00 A:152-495 Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh.hhhhhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------PDEASE_I    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.21        Exon 1.22e  PDB: A:169-201       Exon 1.23b  PDB: A:202-256 UniProt: 374-428            Exon 1.24  PDB: A:257-290         ---------------------------------------------------Exon 1.26a  PDB: A:342-382               Exon 1.27  PDB: A:383-443 UniProt: 555-615                   Exon 1.28c  PDB: A:444-495 UniProt: 616-736          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.25b  PDB: A:290-341 UniProt: 462-513         ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1ro6 A 152 SISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQAPAPPLDEQ 495
                                   161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491

Chain B from PDB  Type:PROTEIN  Length:344
 aligned with PDE4B_HUMAN | Q07343 from UniProtKB/Swiss-Prot  Length:736

    Alignment length:344
                                   333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663    
          PDE4B_HUMAN   324 SISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQ 667
               SCOP domains d1ro6b_ B: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 1ro6B00 B:152-495 Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b                                                                                                                                                                                                                                                                           CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------PDEase_I-1ro6B01 B:233-477                                                                                                                                                                                                                           ------------------ Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------PDEase_I-1ro6B02 B:233-477                                                                                                                                                                                                                           ------------------ Pfam domains (2)
         Sec.struct. author hhhhh..hhhhhhhhhhhhh.......hhhhhhhh...hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------PDEASE_I    ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
           Transcript 1 (1) Exon 1.21        Exon 1.22e  PDB: B:169-201       Exon 1.23b  PDB: B:202-256 UniProt: 374-428            Exon 1.24  PDB: B:257-290         ---------------------------------------------------Exon 1.26a  PDB: B:342-382               Exon 1.27  PDB: B:383-443 UniProt: 555-615                   Exon 1.28c  PDB: B:444-495 UniProt: 616-736          Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------Exon 1.25b  PDB: B:290-341 UniProt: 462-513         ---------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 1ro6 B 152 SISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQAPAPPLDEQ 495
                                   161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: HD-domain/PDEase-like (204)

Superfamily: HD-domain/PDEase-like (204)

Family: PDEase (118)

Protein domain: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b (28)

Human (Homo sapiens) [TaxId: 9606] (28)

1a	d1ro6a_	A:
1b	d1ro6b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b (66)

Homologous Superfamily: Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b (66)

Human (Homo sapiens) (64)

1a	1ro6A00	A:152-495
1b	1ro6B00	B:152-495

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: HD_PDEase (93)

Family: PDEase_I (77)

Homo sapiens (Human) (71)

1a	PDEase_I-1ro6B01	B:233-477
1b	PDEase_I-1ro6B02	B:233-477

Asymmetric Unit(hide GO term definitions)

Chain A,B (PDE4B_HUMAN | Q07343)

molecular function
	GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	Catalysis of the reaction: adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.
	GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.
	GO:0030552	cAMP binding	Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
	GO:0043015	gamma-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein gamma-tubulin.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008081	phosphoric diester hydrolase activity	Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
biological process
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0006198	cAMP catabolic process	The chemical reactions and pathways resulting in the breakdown of the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
	GO:0035690	cellular response to drug	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0071872	cellular response to epinephrine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epinephrine stimulus. Epinephrine is a catecholamine that has the formula C9H13NO3; it is secreted by the adrenal medulla to act as a hormone, and released by certain neurons to act as a neurotransmitter active in the central nervous system.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:1901898	negative regulation of relaxation of cardiac muscle	Any process that stops, prevents or reduces the frequency, rate or extent of relaxation of cardiac muscle.
	GO:0030593	neutrophil chemotaxis	The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0001780	neutrophil homeostasis	The process of regulating the proliferation and elimination of neutrophils such that the total number of neutrophils within a whole or part of an organism is stable over time in the absence of an outside stimulus.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032743	positive regulation of interleukin-2 production	Any process that activates or increases the frequency, rate, or extent of interleukin-2 production.
	GO:0086004	regulation of cardiac muscle cell contraction	Any process that modulates the frequency, rate or extent of cardiac muscle cell contraction.
	GO:1901841	regulation of high voltage-gated calcium channel activity	Any process that modulates the frequency, rate or extent of high voltage-gated calcium channel activity.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0030018	Z disc	Platelike region of a muscle sarcomere to which the plus ends of actin filaments are attached.
	GO:0071944	cell periphery	The part of a cell encompassing the cell cortex, the plasma membrane, and any external encapsulating structures.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0043197	dendritic spine	A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
	GO:0060076	excitatory synapse	A synapse in which an action potential in the presynaptic cell increases the probability of an action potential occurring in the postsynaptic cell.
	GO:0000930	gamma-tubulin complex	A multiprotein complex composed of gamma-tubulin and other non-tubulin proteins. Gamma-tubulin complexes are localized to microtubule organizing centers, and play an important role in the nucleation of microtubules. The number and complexity of non-tubulin proteins associated with these complexes varies between species.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0014069	postsynaptic density of dendrite	An electron dense network of proteins within and adjacent to the postsynaptic membrane of the dendrite of asymetric synapses. Its major components include neurotransmitter receptors and the proteins that spatially and functionally organize them such as anchoring and scaffolding molecules, signaling enzymes and cytoskeletal components.
	GO:0008021	synaptic vesicle	A secretory organelle, typically 50 nm in diameter, of presynaptic nerve terminals; accumulates in high concentrations of neurotransmitters and secretes these into the synaptic cleft by fusion with the 'active zone' of the presynaptic plasma membrane.
	GO:0005891	voltage-gated calcium channel complex	A protein complex that forms a transmembrane channel through which calcium ions may pass in response to changes in membrane potential.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ARS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ROL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Gln A:463 - Pro A:464	[ RasMol ]
		Gln B:463 - Pro B:464	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1ro6
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDE4B_HUMAN \| Q07343
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.4.17
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDE4B_HUMAN \| Q07343
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (4, 7)

Sites (7, 7)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (8, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (33, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File