3G4K - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN PHOSPHODIESTERASE 4D WITH ROLIPRAM

Authors :   B. L. Staker

Date :   03 Feb 09 (Deposition) - 19 Jan 10 (Release) - 19 Jan 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.95

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Phosphodiesterase, Pde4D, Alternative Splicing, Camp, Cytoplasm, Cytoskeleton, Hydrolase, Membrane, Metal- Binding, Phosphoprotein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. B. Burgin, O. T. Magnusson, J. Singh, P. Witte, B. L. Staker, J. M. Bjornsson, M. Thorsteinsdottir, S. Hrafnsdottir, T. Hagen, A. S. Kiselyov, L. J. Stewart, M. E. Gurney
Design Of Phosphodiesterase 4D (Pde4D) Allosteric Modulators For Enhancing Cognition With Improved Safety.
Nat. Biotechnol. V. 28 63 2010
PubMed-ID: 20037581 | Reference-DOI: 10.1038/NBT.1598
(for further references see the PDB file header)

Molecule 1 - CAMP-SPECIFIC 3',5'-CYCLIC PHOSPHODIESTERASE 4D
	Chains	:	A, B, C, D
	EC Number	:	3.1.4.17
	Engineered	:	YES
	Expression System	:	SPODOPTERA FRUGIPERDA
	Expression System Plasmid	:	PBACGUS
	Expression System Taxid	:	7108
	Expression System Vector Type	:	BACULOVIRUS
	Fragment	:	RESIDUES 380-753
	Gene	:	PDE4D, DPDE3
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	DPDE3, PDE43

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (5, 29)

No.	Name	Count	Type	Full Name
1	EDO	14	Ligand/Ion	1,2-ETHANEDIOL
2	MG	4	Ligand/Ion	MAGNESIUM ION
3	ROL	4	Ligand/Ion	ROLIPRAM
4	SO4	3	Ligand/Ion	SULFATE ION
5	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (3, 10)

No.	Name	Count	Type	Full Name
1	EDO	8	Ligand/Ion	1,2-ETHANEDIOL
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	SO4	1	Ligand/Ion	SULFATE ION
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (2, 4)

No.	Name	Count	Type	Full Name
1	EDO	3	Ligand/Ion	1,2-ETHANEDIOL
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	SO4	-1	Ligand/Ion	SULFATE ION
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 3 (3, 3)

No.	Name	Count	Type	Full Name
1	EDO	1	Ligand/Ion	1,2-ETHANEDIOL
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	SO4	1	Ligand/Ion	SULFATE ION
5	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 4 (3, 4)

No.	Name	Count	Type	Full Name
1	EDO	2	Ligand/Ion	1,2-ETHANEDIOL
2	MG	-1	Ligand/Ion	MAGNESIUM ION
3	ROL	1	Ligand/Ion	ROLIPRAM
4	SO4	1	Ligand/Ion	SULFATE ION
5	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (29, 29)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	HIS A:330 , HIS A:366 , ASP A:367 , ASP A:484 , HOH A:646	BINDING SITE FOR RESIDUE ZN A 801
02	AC2	SOFTWARE	HOH A:90 , ASP A:367 , HOH A:626 , HOH A:646 , HOH A:723	BINDING SITE FOR RESIDUE MG A 802
03	AC3	SOFTWARE	HIS A:271 , VAL A:272 , PHE A:273 , ARG A:274 , LEU A:494 , GLN A:497 , HOH A:830	BINDING SITE FOR RESIDUE SO4 A 1
04	AC4	SOFTWARE	TYR A:325 , HIS A:326 , LEU A:485 , ASN A:487 , THR A:499 , ILE A:502 , MET A:503 , PHE A:506 , GLN A:535 , PHE A:538	BINDING SITE FOR RESIDUE ROL A 901
05	AC5	SOFTWARE	LYS A:405 , GLN A:408 , GLU A:409 , HOH A:638 , HOH A:790 , SER C:383 , GLU C:384	BINDING SITE FOR RESIDUE EDO A 624
06	AC6	SOFTWARE	LYS A:428 , ASP A:432 , HOH A:791 , HOH B:148 , HOH B:780	BINDING SITE FOR RESIDUE EDO A 4
07	AC7	SOFTWARE	HIS A:318 , GLU A:409 , HOH C:102 , LEU C:378 , THR C:381 , ARG C:516	BINDING SITE FOR RESIDUE EDO A 6
08	AC8	SOFTWARE	HOH A:237 , PHE A:404 , PHE A:415 , ARG A:423 , ARG A:427 , HOH A:686 , HOH A:960	BINDING SITE FOR RESIDUE EDO A 7
09	AC9	SOFTWARE	SER A:374 , PHE A:506 , GLN A:509 , PRO A:522	BINDING SITE FOR RESIDUE EDO A 9
10	BC1	SOFTWARE	PHE A:377 , THR A:381 , SER A:383 , ARG A:516 , THR C:314 , HIS C:318 , GLU C:409	BINDING SITE FOR RESIDUE EDO A 12
11	BC2	SOFTWARE	THR A:300 , ASN A:417 , GLN A:422 , HOH A:659 , ASP D:557	BINDING SITE FOR RESIDUE EDO A 13
12	BC3	SOFTWARE	LEU A:341 , THR A:344 , TRP A:550 , VAL A:554 , ASP A:557 , HOH A:983	BINDING SITE FOR RESIDUE EDO A 14
13	BC4	SOFTWARE	HIS B:330 , HIS B:366 , ASP B:367 , ASP B:484 , HOH B:674 , HOH B:733	BINDING SITE FOR RESIDUE ZN B 803
14	BC5	SOFTWARE	HOH B:109 , HOH B:128 , ASP B:367 , HOH B:640 , HOH B:674 , HOH B:981	BINDING SITE FOR RESIDUE MG B 804
15	BC6	SOFTWARE	TYR B:325 , HIS B:326 , LEU B:485 , ASN B:487 , THR B:499 , ILE B:502 , MET B:503 , MET B:523 , SER B:534 , GLN B:535 , PHE B:538 , HOH B:733 , HOH B:913 , HOH B:981	BINDING SITE FOR RESIDUE ROL B 902
16	BC7	SOFTWARE	THR B:314 , HIS B:318 , GLU B:409 , HOH B:650 , HOH B:660 , PHE D:377 , THR D:381	BINDING SITE FOR RESIDUE EDO B 3
17	BC8	SOFTWARE	HOH A:685 , HOH B:103 , LYS B:428 , ASP B:432	BINDING SITE FOR RESIDUE EDO B 8
18	BC9	SOFTWARE	HIS B:271 , VAL B:272 , PHE B:273 , ARG B:274 , GLN B:493 , LEU B:494	BINDING SITE FOR RESIDUE EDO B 11
19	CC1	SOFTWARE	HIS C:330 , HIS C:366 , ASP C:367 , ASP C:484 , HOH C:642 , HOH C:796	BINDING SITE FOR RESIDUE ZN C 805
20	CC2	SOFTWARE	HOH C:130 , ASP C:367 , HOH C:642 , HOH C:684 , HOH C:729 , HOH C:880	BINDING SITE FOR RESIDUE MG C 806
21	CC3	SOFTWARE	HIS C:271 , VAL C:272 , PHE C:273 , ARG C:274 , LEU C:494 , GLN C:497 , HOH C:647	BINDING SITE FOR RESIDUE SO4 C 3
22	CC4	SOFTWARE	TYR C:325 , HIS C:326 , LEU C:485 , ASN C:487 , THR C:499 , ILE C:502 , MET C:503 , MET C:523 , SER C:534 , GLN C:535 , PHE C:538 , HOH C:796 , HOH C:880	BINDING SITE FOR RESIDUE ROL C 903
23	CC5	SOFTWARE	LYS C:428 , ASP C:432 , HOH C:638 , HOH D:239	BINDING SITE FOR RESIDUE EDO C 5
24	CC6	SOFTWARE	HOH D:45 , HIS D:330 , HIS D:366 , ASP D:367 , ASP D:484 , HOH D:798	BINDING SITE FOR RESIDUE ZN D 807
25	CC7	SOFTWARE	HOH D:76 , ASP D:367 , HOH D:626 , HOH D:656 , HOH D:798 , HOH D:1063	BINDING SITE FOR RESIDUE MG D 808
26	CC8	SOFTWARE	HIS D:271 , VAL D:272 , PHE D:273 , ARG D:274 , GLN D:493 , LEU D:494 , GLN D:497	BINDING SITE FOR RESIDUE SO4 D 2
27	CC9	SOFTWARE	HOH D:45 , TYR D:325 , HIS D:326 , LEU D:485 , ASN D:487 , TYR D:495 , TRP D:498 , THR D:499 , ILE D:502 , PHE D:506 , MET D:523 , SER D:534 , GLN D:535 , PHE D:538 , HOH D:1063 , HOH D:1067	BINDING SITE FOR RESIDUE ROL D 904
28	DC1	SOFTWARE	HOH C:36 , HOH C:672 , LYS D:428 , ASP D:432	BINDING SITE FOR RESIDUE EDO D 624
29	DC2	SOFTWARE	PHE B:377 , LEU B:378 , THR B:381 , ARG B:516 , HOH D:221 , THR D:314 , HIS D:318 , GLU D:409	BINDING SITE FOR RESIDUE EDO D 10

(no "SS Bond" information available for 3G4K)

Asymmetric Unit

No.	Residues
1	His A:555	-	Pro A:556
2	His B:555	-	Pro B:556
3	His C:555	-	Pro C:556
4	His D:555	-	Pro D:556

Asymmetric Unit (4, 16)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068245	T	587	P	PDE4D_HUMAN	Disease (ACRDYS2)	397514467	A/B/C/D	T	451	P
2	UniProt	VAR_069453	E	590	A	PDE4D_HUMAN	Disease (ACRDYS2)	---	A/B/C/D	E	454	A
3	UniProt	VAR_069454	G	673	D	PDE4D_HUMAN	Disease (ACRDYS2)	397514469	A/B/C/D	G	537	D
4	UniProt	VAR_069455	I	678	T	PDE4D_HUMAN	Disease (ACRDYS2)	587777188	A/B/C/D	I	542	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068245	T	587	P	PDE4D_HUMAN	Disease (ACRDYS2)	397514467	A	T	451	P
2	UniProt	VAR_069453	E	590	A	PDE4D_HUMAN	Disease (ACRDYS2)	---	A	E	454	A
3	UniProt	VAR_069454	G	673	D	PDE4D_HUMAN	Disease (ACRDYS2)	397514469	A	G	537	D
4	UniProt	VAR_069455	I	678	T	PDE4D_HUMAN	Disease (ACRDYS2)	587777188	A	I	542	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068245	T	587	P	PDE4D_HUMAN	Disease (ACRDYS2)	397514467	B	T	451	P
2	UniProt	VAR_069453	E	590	A	PDE4D_HUMAN	Disease (ACRDYS2)	---	B	E	454	A
3	UniProt	VAR_069454	G	673	D	PDE4D_HUMAN	Disease (ACRDYS2)	397514469	B	G	537	D
4	UniProt	VAR_069455	I	678	T	PDE4D_HUMAN	Disease (ACRDYS2)	587777188	B	I	542	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068245	T	587	P	PDE4D_HUMAN	Disease (ACRDYS2)	397514467	C	T	451	P
2	UniProt	VAR_069453	E	590	A	PDE4D_HUMAN	Disease (ACRDYS2)	---	C	E	454	A
3	UniProt	VAR_069454	G	673	D	PDE4D_HUMAN	Disease (ACRDYS2)	397514469	C	G	537	D
4	UniProt	VAR_069455	I	678	T	PDE4D_HUMAN	Disease (ACRDYS2)	587777188	C	I	542	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_068245	T	587	P	PDE4D_HUMAN	Disease (ACRDYS2)	397514467	D	T	451	P
2	UniProt	VAR_069453	E	590	A	PDE4D_HUMAN	Disease (ACRDYS2)	---	D	E	454	A
3	UniProt	VAR_069454	G	673	D	PDE4D_HUMAN	Disease (ACRDYS2)	397514469	D	G	537	D
4	UniProt	VAR_069455	I	678	T	PDE4D_HUMAN	Disease (ACRDYS2)	587777188	D	I	542	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4D_HUMAN	502-513	4	A:366-377 B:366-377 C:366-377 D:366-377

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4D_HUMAN	502-513	1	A:366-377 - - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4D_HUMAN	502-513	1	- B:366-377 - -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4D_HUMAN	502-513	1	- - C:366-377 -

Biological Unit 4 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PDEASE_I	PS00126	3'5'-cyclic nucleotide phosphodiesterases signature.	PDE4D_HUMAN	502-513	1	- - - D:366-377

Asymmetric Unit (8, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.13a	ENST00000340635	13a	ENSE00001559328	chr5:59189625-59188995	631	PDE4D_HUMAN	1-152	152	0	-	-
1.21b	ENST00000340635	21b	ENSE00001136096	chr5:58511794-58511603	192	PDE4D_HUMAN	152-216	65	0	-	-
1.22	ENST00000340635	22	ENSE00001682119	chr5:58489362-58489326	37	PDE4D_HUMAN	216-228	13	0	-	-
1.23	ENST00000340635	23	ENSE00001754547	chr5:58481088-58481015	74	PDE4D_HUMAN	229-253	25	0	-	-
1.24	ENST00000340635	24	ENSE00001719283	chr5:58476470-58476421	50	PDE4D_HUMAN	253-270	18	0	-	-
1.31d	ENST00000340635	31d	ENSE00001750566	chr5:58334798-58334686	113	PDE4D_HUMAN	270-307	38	0	-	-
1.33b	ENST00000340635	33b	ENSE00000914184	chr5:58289292-58289199	94	PDE4D_HUMAN	308-339	32	0	-	-
1.34	ENST00000340635	34	ENSE00001136103	chr5:58287831-58287659	173	PDE4D_HUMAN	339-396	58	4	A:248-260 B:253-260 C:252-260 D:246-260	13 8 9 15
1.35	ENST00000340635	35	ENSE00001001090	chr5:58286729-58286631	99	PDE4D_HUMAN	397-429	33	4	A:261-293 B:261-293 C:261-293 D:261-293	33 33 33 33
1.36	ENST00000340635	36	ENSE00001001087	chr5:58285746-58285582	165	PDE4D_HUMAN	430-484	55	4	A:294-348 B:294-348 C:294-348 D:294-348	55 55 55 55
1.37	ENST00000340635	37	ENSE00001001091	chr5:58284419-58284320	100	PDE4D_HUMAN	485-518	34	4	A:349-382 B:349-382 C:349-382 D:349-382	34 34 34 34
1.38	ENST00000340635	38	ENSE00001175221	chr5:58273172-58273018	155	PDE4D_HUMAN	518-569	52	4	A:382-433 B:382-433 C:382-433 D:382-433	52 52 52 52
1.39	ENST00000340635	39	ENSE00001001088	chr5:58272299-58272177	123	PDE4D_HUMAN	570-610	41	4	A:434-474 B:434-474 C:434-474 D:434-474	41 41 41 41
1.40	ENST00000340635	40	ENSE00001698537	chr5:58271666-58271484	183	PDE4D_HUMAN	611-671	61	4	A:475-535 B:475-535 C:475-535 D:475-535	61 61 61 61
1.41j	ENST00000340635	41j	ENSE00001989721	chr5:58270907-58264865	6043	PDE4D_HUMAN	672-809	138	4	A:536-577 B:536-578 C:536-578 D:536-578	42 43 43 43

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:330
 aligned with PDE4D_HUMAN | Q08499 from UniProtKB/Swiss-Prot  Length:809

    Alignment length:330
                                   393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673       683       693       703       713
          PDE4D_HUMAN   384 FGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIP 713
               SCOP domains d3g4ka_ A: Catalytic domain of cyclic nucleotide phosphodiesterase pde4d                                                                                                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhh.......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--A----------------------------------------------------------------------------------D----T----------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------PDEASE_I    -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.34    Exon 1.35  PDB: A:261-293        Exon 1.36  PDB: A:294-348 UniProt: 430-484             Exon 1.37  PDB: A:349-382         ---------------------------------------------------Exon 1.39  PDB: A:434-474                Exon 1.40  PDB: A:475-535 UniProt: 611-671                   Exon 1.41j  PDB: A:536-577 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------------------Exon 1.38  PDB: A:382-433 UniProt: 518-569          ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1 (2)
                 3g4k A 248 FGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIP 577
                                   257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577

Chain B from PDB  Type:PROTEIN  Length:326
 aligned with PDE4D_HUMAN | Q08499 from UniProtKB/Swiss-Prot  Length:809

    Alignment length:326
                                   398       408       418       428       438       448       458       468       478       488       498       508       518       528       538       548       558       568       578       588       598       608       618       628       638       648       658       668       678       688       698       708      
          PDE4D_HUMAN   389 EQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 714
               SCOP domains d3g4kb_ B: Catalytic domain of cyclic nucleotide phosphodiesterase pde4d                                                                                                                                                                                                                                                               SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhh.....hhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--A----------------------------------------------------------------------------------D----T------------------------------------ SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------PDEASE_I    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.34    Exon 1.35  PDB: B:261-293        Exon 1.36  PDB: B:294-348 UniProt: 430-484             Exon 1.37  PDB: B:349-382         ---------------------------------------------------Exon 1.39  PDB: B:434-474                Exon 1.40  PDB: B:475-535 UniProt: 611-671                   Exon 1.41j  PDB: B:536-578 UniProt: 672-809 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------------------------------------------------------------------Exon 1.38  PDB: B:382-433 UniProt: 518-569          ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3g4k B 253 EQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 578
                                   262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572

Chain C from PDB  Type:PROTEIN  Length:327
 aligned with PDE4D_HUMAN | Q08499 from UniProtKB/Swiss-Prot  Length:809

    Alignment length:327
                                   397       407       417       427       437       447       457       467       477       487       497       507       517       527       537       547       557       567       577       587       597       607       617       627       637       647       657       667       677       687       697       707       
          PDE4D_HUMAN   388 TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 714
               SCOP domains d3g4kc_ C: Catalytic domain of cyclic nucleotide phosphodiesterase pde4d                                                                                                                                                                                                                                                                SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhh.......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--A----------------------------------------------------------------------------------D----T------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------PDEASE_I    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.34Exon 1.35  PDB: C:261-293        Exon 1.36  PDB: C:294-348 UniProt: 430-484             Exon 1.37  PDB: C:349-382         ---------------------------------------------------Exon 1.39  PDB: C:434-474                Exon 1.40  PDB: C:475-535 UniProt: 611-671                   Exon 1.41j  PDB: C:536-578 UniProt: 672-809 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------Exon 1.38  PDB: C:382-433 UniProt: 518-569          ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3g4k C 252 TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 578
                                   261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571

Chain D from PDB  Type:PROTEIN  Length:333
 aligned with PDE4D_HUMAN | Q08499 from UniProtKB/Swiss-Prot  Length:809

    Alignment length:333
                                   391       401       411       421       431       441       451       461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       661       671       681       691       701       711   
          PDE4D_HUMAN   382 PRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 714
               SCOP domains d3g4kd_ D: Catalytic domain of cyclic nucleotide phosphodiesterase pde4d                                                                                                                                                                                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhh.......hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh.......hhhhhhhh.hhhhhhh...hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--A----------------------------------------------------------------------------------D----T------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------PDEASE_I    --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.34      Exon 1.35  PDB: D:261-293        Exon 1.36  PDB: D:294-348 UniProt: 430-484             Exon 1.37  PDB: D:349-382         ---------------------------------------------------Exon 1.39  PDB: D:434-474                Exon 1.40  PDB: D:475-535 UniProt: 611-671                   Exon 1.41j  PDB: D:536-578 UniProt: 672-809 Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------Exon 1.38  PDB: D:382-433 UniProt: 518-569          ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3g4k D 246 PRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQ 578
                                   255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: HD-domain/PDEase-like (204)

Superfamily: HD-domain/PDEase-like (204)

Family: PDEase (118)

Protein domain: Catalytic domain of cyclic nucleotide phosphodiesterase pde4d (33)

Human (Homo sapiens) [TaxId: 9606] (33)

1a	d3g4ka_	A:
1b	d3g4kb_	B:
1c	d3g4kc_	C:
1d	d3g4kd_	D:

(no "CATH Domain" information available for 3G4K)

(no "Pfam Domain" information available for 3G4K)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (PDE4D_HUMAN | Q08499)

molecular function
	GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	Catalysis of the reaction: adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.
	GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	Catalysis of the reaction: nucleoside 3',5'-cyclic phosphate + H2O = nucleoside 5'-phosphate.
	GO:0051117	ATPase binding	Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
	GO:0031698	beta-2 adrenergic receptor binding	Interacting selectively and non-covalently with a beta-2 adrenergic receptor.
	GO:0030552	cAMP binding	Interacting selectively and non-covalently with cAMP, the nucleotide cyclic AMP (adenosine 3',5'-cyclophosphate).
	GO:0008144	drug binding	Interacting selectively and non-covalently with a drug, any naturally occurring or synthetic substance, other than a nutrient, that, when administered or applied to an organism, affects the structure or functioning of the organism; in particular, any such substance used in the diagnosis, prevention, or treatment of disease.
	GO:0019899	enzyme binding	Interacting selectively and non-covalently with any enzyme.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0044325	ion channel binding	Interacting selectively and non-covalently with one or more specific sites on an ion channel, a protein complex that spans a membrane and forms a water-filled channel across the phospholipid bilayer allowing selective ion transport down its electrochemical gradient.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0008081	phosphoric diester hydrolase activity	Catalysis of the hydrolysis of a phosphodiester to give a phosphomonoester and a free hydroxyl group.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0097110	scaffold protein binding	Interacting selectively and non-covalently with a scaffold protein. Scaffold proteins are crucial regulators of many key signaling pathways. Although not strictly defined in function, they are known to interact and/or bind with multiple members of a signaling pathway, tethering them into complexes.
	GO:0031625	ubiquitin protein ligase binding	Interacting selectively and non-covalently with a ubiquitin protein ligase enzyme, any of the E3 proteins.
biological process
	GO:0050852	T cell receptor signaling pathway	A series of molecular signals initiated by the cross-linking of an antigen receptor on a T cell.
	GO:0071875	adrenergic receptor signaling pathway	A series of molecular signals generated as a consequence of an adrenergic receptor binding to one of its physiological ligands.
	GO:0086024	adrenergic receptor signaling pathway involved in positive regulation of heart rate	An adrenergic receptor signaling pathway that contributes to an increase in frequency or rate of heart contraction. Binding of adrenalin or noradrenalin to a beta-adrenergic receptor on the surface of the signal-receiving cell results in the activation of an intracellular Gs protein. Gs activates adenylate cyclase to increase intracellular cyclic-AMP (cAMP) levels. cAMP binds directly to F-channels to allow an inward flow of sodium (known as funny current, or If current). The funny current is responsible for membrane depolarization and an increase in heart rate.
	GO:0007568	aging	A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
	GO:0006198	cAMP catabolic process	The chemical reactions and pathways resulting in the breakdown of the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
	GO:0019933	cAMP-mediated signaling	Any intracellular signal transduction in which the signal is passed on within the cell via cyclic AMP (cAMP). Includes production of cAMP, and downstream effectors that further transmit the signal within the cell.
	GO:0071320	cellular response to cAMP	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate) stimulus.
	GO:0071872	cellular response to epinephrine stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an epinephrine stimulus. Epinephrine is a catecholamine that has the formula C9H13NO3; it is secreted by the adrenal medulla to act as a hormone, and released by certain neurons to act as a neurotransmitter active in the central nervous system.
	GO:0071222	cellular response to lipopolysaccharide	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
	GO:0061028	establishment of endothelial barrier	The establishment of a barrier between endothelial cell layers, such as those in the brain, lung or intestine, to exert specific and selective control over the passage of water and solutes, thus allowing formation and maintenance of compartments that differ in fluid and solute composition.
	GO:0050900	leukocyte migration	The movement of a leukocyte within or between different tissues and organs of the body.
	GO:0035264	multicellular organism growth	The increase in size or mass of an entire multicellular organism, as opposed to cell growth.
	GO:0045822	negative regulation of heart contraction	Any process that stops, prevents, or reduces the frequency, rate or extent of heart contraction.
	GO:0033137	negative regulation of peptidyl-serine phosphorylation	Any process that stops, prevents, or reduces the frequency, rate or extent of the phosphorylation of peptidyl-serine.
	GO:1901898	negative regulation of relaxation of cardiac muscle	Any process that stops, prevents or reduces the frequency, rate or extent of relaxation of cardiac muscle.
	GO:0030593	neutrophil chemotaxis	The directed movement of a neutrophil cell, the most numerous polymorphonuclear leukocyte found in the blood, in response to an external stimulus, usually an infection or wounding.
	GO:0032729	positive regulation of interferon-gamma production	Any process that activates or increases the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
	GO:0032743	positive regulation of interleukin-2 production	Any process that activates or increases the frequency, rate, or extent of interleukin-2 production.
	GO:0032754	positive regulation of interleukin-5 production	Any process that activates or increases the frequency, rate, or extent of interleukin-5 production.
	GO:0030814	regulation of cAMP metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving the nucleotide cAMP (cyclic AMP, adenosine 3',5'-cyclophosphate).
	GO:0086004	regulation of cardiac muscle cell contraction	Any process that modulates the frequency, rate or extent of cardiac muscle cell contraction.
	GO:1901844	regulation of cell communication by electrical coupling involved in cardiac conduction	Any process that modulates the frequency, rate or extent of cell communication by electrical coupling involved in cardiac conduction.
	GO:0002027	regulation of heart rate	Any process that modulates the frequency or rate of heart contraction.
	GO:0010469	regulation of receptor activity	Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
	GO:0010880	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
	GO:0060314	regulation of ryanodine-sensitive calcium-release channel activity	Any process that modulates the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0006939	smooth muscle contraction	A process in which force is generated within smooth muscle tissue, resulting in a change in muscle geometry. Force generation involves a chemo-mechanical energy conversion step that is carried out by the actin/myosin complex activity, which generates force through ATP hydrolysis. Smooth muscle differs from striated muscle in the much higher actin/myosin ratio, the absence of conspicuous sarcomeres and the ability to contract to a much smaller fraction of its resting length.
cellular component
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0034704	calcium channel complex	An ion channel complex through which calcium ions pass.
	GO:0005813	centrosome	A structure comprised of a core structure (in most organisms, a pair of centrioles) and peripheral material from which a microtubule-based structure, such as a spindle apparatus, is organized. Centrosomes occur close to the nucleus during interphase in many eukaryotic cells, though in animal cells it changes continually during the cell-division cycle.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005815	microtubule organizing center	An intracellular structure that can catalyze gamma-tubulin-dependent microtubule nucleation and that can anchor microtubules by interacting with their minus ends, plus ends or sides.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
	GO:0005891	voltage-gated calcium channel complex	A protein complex that forms a transmembrane channel through which calcium ions may pass in response to changes in membrane potential.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		EDO	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ROL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]
		BC2	[ RasMol ]	+environment [ RasMol ]
		BC3	[ RasMol ]	+environment [ RasMol ]
		BC4	[ RasMol ]	+environment [ RasMol ]
		BC5	[ RasMol ]	+environment [ RasMol ]
		BC6	[ RasMol ]	+environment [ RasMol ]
		BC7	[ RasMol ]	+environment [ RasMol ]
		BC8	[ RasMol ]	+environment [ RasMol ]
		BC9	[ RasMol ]	+environment [ RasMol ]
		CC1	[ RasMol ]	+environment [ RasMol ]
		CC2	[ RasMol ]	+environment [ RasMol ]
		CC3	[ RasMol ]	+environment [ RasMol ]
		CC4	[ RasMol ]	+environment [ RasMol ]
		CC5	[ RasMol ]	+environment [ RasMol ]
		CC6	[ RasMol ]	+environment [ RasMol ]
		CC7	[ RasMol ]	+environment [ RasMol ]
		CC8	[ RasMol ]	+environment [ RasMol ]
		CC9	[ RasMol ]	+environment [ RasMol ]
		DC1	[ RasMol ]	+environment [ RasMol ]
		DC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		His A:555 - Pro A:556	[ RasMol ]
		His B:555 - Pro B:556	[ RasMol ]
		His C:555 - Pro C:556	[ RasMol ]
		His D:555 - Pro D:556	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3g4k
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDE4D_HUMAN \| Q08499
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.4.17
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	614613
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDE4D_HUMAN \| Q08499
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (5, 29)

Sites (29, 29)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 16)

PROSITE Motifs (1, 4)

Exons (8, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (52, 52)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File