|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 3G19) |
Sites (0, 0)| (no "Site" information available for 3G19) |
SS Bonds (0, 0)| (no "SS Bond" information available for 3G19) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3G19) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3G19) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3G19) |
Exons (0, 0)| (no "Exon" information available for 3G19) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:84 aligned with CLPS_CAUCR | Q9A5I0 from UniProtKB/Swiss-Prot Length:119 Alignment length:84 45 55 65 75 85 95 105 115 CLPS_CAUCR 36 QKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD 119 SCOP domains d3g19a_ A: automated matches SCOP domains CATH domains 3g19A00 A:36-119 [code=3.30.1390.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 3g19 A 36 QKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD 119 45 55 65 75 85 95 105 115
Chain C from PDB Type:PROTEIN Length:3
SCOP domains --- SCOP domains
CATH domains --- CATH domains
Pfam domains --- Pfam domains
SAPs(SNPs) --- SAPs(SNPs)
PROSITE --- PROSITE
Transcript --- Transcript
3g19 C 1 LLL 3
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3G19) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (CLPS_CAUCR | Q9A5I0)
|
||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|