|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3F8C) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3F8C) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3F8C) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3F8C) |
Exons (0, 0)| (no "Exon" information available for 3F8C) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with A2RI36_LACLM | A2RI36 from UniProtKB/TrEMBL Length:116 Alignment length:106 12 22 32 42 52 62 72 82 92 102 A2RI36_LACLM 3 EIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA 108 SCOP domains d3f8ca_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 3f8c A 3 EIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDE---GRRKYYRLTEIGHENMRLAFESWSRVDKIIENLEA 108 12 22 32 42 52 62 | - | 82 92 102 70 74
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 3F8C) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3F8C) |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3F8C)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|