3EIQ - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF PDCD4-EIF4A

Authors :   P. G. Loh, Z. Cheng, H. Song

Date :   17 Sep 08 (Deposition) - 24 Feb 09 (Release) - 16 Oct 13 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.50

Chains :   Asym./Biol. Unit : A,C,D

Keywords :   Pdcd4, Anti-Oncogene, Apoptosis, Cell Cycle, Nucleus, Phosphoprotein, Rna-Binding, Atp-Binding, Helicase, Hydrolase, Initiation Factor, Nucleotide-Binding, Protein Biosynthesis, Antitumor Protein, Translation, Hydrolase-Antitumor Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. G. Loh, H. S. Yang, M. A. Walsh, Q. Wang, X. Wang, Z. Cheng, D. Liu, H. Song
Structural Basis For Translational Inhibition By The Tumour Suppressor Pdcd4
Embo J. V. 28 274 2009
PubMed-ID: 19153607 | Reference-DOI: 10.1038/EMBOJ.2008.278

Molecule 1 - EUKARYOTIC INITIATION FACTOR 4A-I
	Chains	:	A, D
	EC Number	:	3.6.1.-
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-6P-1
	Expression System Strain	:	BL21STAR
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	EIF-4A-I, EIF4A-I, ATP-DEPENDENT RNA HELICASE EIF4A-1

Molecule 2 - PROGRAMMED CELL DEATH PROTEIN 4
	Chains	:	C
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PGEX-6P-1
	Expression System Strain	:	BL21STAR
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 120-469
	Organism Common	:	MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	TOPOISOMERASE-INHIBITOR SUPPRESSED PROTEIN, PROTEIN MA-3

		1	2	3
Asymmetric/Biological Unit	:	A	C	D

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 3EIQ)

(no "Site" information available for 3EIQ)

(no "SS Bond" information available for 3EIQ)

Asymmetric/Biological Unit

No.	Residues
1	Ile A:135	-	Gly A:136
2	Gly A:136	-	Gly A:137
3	Gln A:148	-	Met A:149
4	Met A:149	-	Glu A:150
5	Glu A:150	-	Ala A:151
6	Val C:314	-	Trp C:315
7	Ser C:317	-	Gly C:318
8	Thr D:80	-	Gly D:81
9	Ile D:135	-	Gly D:136
10	Gly D:136	-	Gly D:137
11	Gln D:148	-	Met D:149
12	Met D:149	-	Glu D:150
13	Glu D:240	-	Leu D:241
14	Arg D:365	-	Phe D:366
15	Gly D:367	-	Arg D:368

(no "SAP(SNP)/Variant" information available for 3EIQ)

Asymmetric/Biological Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	Q_MOTIF	PS51195	DEAD-box RNA helicase Q motif profile.	IF4A1_HUMAN	32-60	2	A:32-60 D:32-60
2	MI	PS51366	MI domain profile.	PDCD4_MOUSE	163-284 326-449	2	C:163-283 C:326-449
3	DEAD_ATP_HELICASE	PS00039	DEAD-box subfamily ATP-dependent helicases signature.	IF4A1_HUMAN	180-188	2	A:180-188 D:180-188

Asymmetric/Biological Unit (10, 20)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000293831	1a	ENSE00001710114	chr17:7476024-7476182	159	IF4A1_HUMAN	1-8	8	0	-	-
1.2	ENST00000293831	2	ENSE00001631751	chr17:7477578-7477626	49	IF4A1_HUMAN	8-24	17	2	A:22-24 D:22-24	3 3
1.3	ENST00000293831	3	ENSE00001762686	chr17:7477864-7477996	133	IF4A1_HUMAN	25-69	45	2	A:25-69 D:25-69	45 45
1.4a	ENST00000293831	4a	ENSE00001726391	chr17:7478437-7478576	140	IF4A1_HUMAN	69-115	47	2	A:69-115 D:69-115	47 47
1.5	ENST00000293831	5	ENSE00001061690	chr17:7479842-7480010	169	IF4A1_HUMAN	116-172	57	2	A:116-172 D:116-172	57 57
1.6	ENST00000293831	6	ENSE00001061689	chr17:7480374-7480483	110	IF4A1_HUMAN	172-208	37	2	A:172-208 D:172-208	37 37
1.7	ENST00000293831	7	ENSE00001061692	chr17:7480662-7480805	144	IF4A1_HUMAN	209-256	48	2	A:209-256 D:209-256	48 48
1.8	ENST00000293831	8	ENSE00001799518	chr17:7480887-7481024	138	IF4A1_HUMAN	257-302	46	2	A:257-302 D:257-302	46 46
1.9	ENST00000293831	9	ENSE00001061685	chr17:7481145-7481234	90	IF4A1_HUMAN	303-332	30	2	A:306-332 (gaps) D:305-332 (gaps)	27 28
1.10	ENST00000293831	10	ENSE00001061694	chr17:7481483-7481562	80	IF4A1_HUMAN	333-359	27	2	A:333-359 (gaps) D:333-359	27 27
1.11	ENST00000293831	11	ENSE00001485271	chr17:7481660-7482324	665	IF4A1_HUMAN	359-406	48	2	A:359-400 (gaps) D:359-400	42 42

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:364
 aligned with IF4A1_HUMAN | P60842 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:379
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391         
          IF4A1_HUMAN    22 VIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPL 400
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhh.hhhhhhhhhhh.....hhhhhhhhhhhhh...eee.......hhhhhhhhhhhhh........eeee..hhhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhh.....eeeehhhhhhhhhhh.........eeee.hhhhhhhh.hhhhhhhhhh......eeeee....hhhhhhhhh......eee.............eeeee.....hhhhhhhhhhhh......eee..hhhhhhhhhhhhhh.....eee---hhhhhhhhhhhhhh..---.eee.....--.hhhhh..eee.......hhhhhhh..-------..eeeee..hhhhhhhhhhhhh....ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------Q_MOTIF  PDB: A:32-60        ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------DEAD_ATP_-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.2Exon 1.3  PDB: A:25-69 UniProt: 25-69        ----------------------------------------------Exon 1.5  PDB: A:116-172 UniProt: 116-172                ------------------------------------Exon 1.7  PDB: A:209-256 UniProt: 209-256       Exon 1.8  PDB: A:257-302 UniProt: 257-302     Exon 1.9  PDB: A:306-332 (gapsExon 1.10 UniProt: 333-359 ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.4a  PDB: A:69-115 UniProt: 69-115       --------------------------------------------------------Exon 1.6  PDB: A:172-208             ------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:359-400 (gaps)           Transcript 1 (2)
                 3eiq A  22 VIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAM---MDQKERDVIMREFRSG---VLITTDLLA--IDVQQVSLVINYDLPTNRENYIHRIGR-------GVAINMVTEEDKRTLRDIETFYNTSIEEMPL 400
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301|   |  311       321   |   331 |  |  341       351       361|      371       381       391         
                                                                                                                                                                                                                                                                                                                  302 306            321 325     333  |                       362     370                              
                                                                                                                                                                                                                                                                                                                                                    336

Chain C from PDB  Type:PROTEIN  Length:278
 aligned with PDCD4_MOUSE | Q61823 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:290
                                   170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450
          PDCD4_MOUSE   161 ETAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR 450
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.......hhhhh---.hhhhhhhhhhhhhhhh.---------.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --MI  PDB: C:163-283 UniProt: 163-284                                                                                       -----------------------------------------MI  PDB: C:326-449 UniProt: 326-449                                                                                         - PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3eiq C 161 ETAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTNDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYK---DCVQARAALDKATVLLSM---------VWGSGGGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSR 450
                                   170       180       190       200       210       220       230       240       250       260       270       280  |   |290       300   |     -   |   320       330       340       350       360       370       380       390       400       410       420       430       440       450
                                                                                                                                                    283 287              304       314

Chain D from PDB  Type:PROTEIN  Length:371
 aligned with IF4A1_HUMAN | P60842 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:379
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391         
          IF4A1_HUMAN    22 VIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPL 400
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........hhhhhh.hhhhhhhhhhh.......hhhhhhhhhhh...eee.......hhhhhhhhhhhhh........eeee..hhhhhhhhhhhhhhhhhhh...eee.....hhhhhhhhhh.....eeeehhhhhhhhhhh.........eeee.hhhhhhhh.hhhhhhhhhh......eeeee....hhhhhhhhhh.....eee............eeeeee....hhhhhhhhhhhhhh.....eee..hhhhhhhhhhhhhh.....eee--.hhhhhhhhhhhhh------.eee..hhhhhhhhhhh.eeee......hhhhhhhh..........eeeeee..hhhhhhhhhhhhh....ee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------Q_MOTIF  PDB: D:32-60        ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------------------------------------DEAD_ATP_-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) 1.2Exon 1.3  PDB: D:25-69 UniProt: 25-69        ----------------------------------------------Exon 1.5  PDB: D:116-172 UniProt: 116-172                ------------------------------------Exon 1.7  PDB: D:209-256 UniProt: 209-256       Exon 1.8  PDB: D:257-302 UniProt: 257-302     Exon 1.9  PDB: D:305-332 (gapsExon 1.10  PDB: D:333-359  ----------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.4a  PDB: D:69-115 UniProt: 69-115       --------------------------------------------------------Exon 1.6  PDB: D:172-208             ------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: D:359-400 UniProt: 359-406 Transcript 1 (2)
                 3eiq D  22 VIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAM--DMDQKERDVIMREF------VLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMPL 400
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301|  |   311      |  -   |   331       341       351       361       371       381       391         
                                                                                                                                                                                                                                                                                                                  302  |          318    325                                                                           
                                                                                                                                                                                                                                                                                                                     305

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 3EIQ)

(no "CATH Domain" information available for 3EIQ)

(no "Pfam Domain" information available for 3EIQ)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,D (IF4A1_HUMAN | P60842)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004004	ATP-dependent RNA helicase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate; this reaction drives the unwinding of an RNA helix.
	GO:0016887	ATPase activity	Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0000339	RNA cap binding	Interacting selectively and non-covalently with a 7-methylguanosine (m7G) group or derivative located at the 5' end of an RNA molecule.
	GO:0003725	double-stranded RNA binding	Interacting selectively and non-covalently with double-stranded RNA.
	GO:0004386	helicase activity	Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0003729	mRNA binding	Interacting selectively and non-covalently with messenger RNA (mRNA), an intermediate molecule between DNA and protein. mRNA includes UTR and coding sequences, but does not contain introns.
	GO:0003676	nucleic acid binding	Interacting selectively and non-covalently with any nucleic acid.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008135	translation factor activity, RNA binding	Functions during translation by interacting selectively and non-covalently with RNA during polypeptide synthesis at the ribosome.
	GO:0003743	translation initiation factor activity	Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
	GO:0010501	RNA secondary structure unwinding	The process in which a secondary structure of RNA are broken or 'melted'.
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	Shortening of the poly(A) tail of a nuclear-transcribed mRNA from full length to an oligo(A) length.
	GO:0010468	regulation of gene expression	Any process that modulates the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006413	translational initiation	The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0016281	eukaryotic translation initiation factor 4F complex	The eukaryotic translation initiation factor 4F complex is composed of eIF4E, eIF4A and eIF4G; it is involved in the recognition of the mRNA cap, ATP-dependent unwinding of the 5'-terminal secondary structure and recruitment of the mRNA to the ribosome.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain C (PDCD4_MOUSE | Q61823)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007569	cell aging	An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
	GO:0043508	negative regulation of JUN kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of JUN kinase activity.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:1904761	negative regulation of myofibroblast differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of myofibroblast differentiation.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0051246	regulation of protein metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3eiq)

	Sites
(no "Sites" information available for 3eiq)

	Cis Peptide Bonds
		Arg D:365 - Phe D:366	[ RasMol ]
		Gln A:148 - Met A:149	[ RasMol ]
		Gln D:148 - Met D:149	[ RasMol ]
		Glu A:150 - Ala A:151	[ RasMol ]
		Glu D:240 - Leu D:241	[ RasMol ]
		Gly A:136 - Gly A:137	[ RasMol ]
		Gly D:136 - Gly D:137	[ RasMol ]
		Gly D:367 - Arg D:368	[ RasMol ]
		Ile A:135 - Gly A:136	[ RasMol ]
		Ile D:135 - Gly D:136	[ RasMol ]
		Met A:149 - Glu A:150	[ RasMol ]
		Met D:149 - Glu D:150	[ RasMol ]
		Ser C:317 - Gly C:318	[ RasMol ]
		Thr D:80 - Gly D:81	[ RasMol ]
		Val C:314 - Trp C:315	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3eiq
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IF4A1_HUMAN \| P60842
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PDCD4_MOUSE \| Q61823
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.1.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IF4A1_HUMAN \| P60842
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PDCD4_MOUSE \| Q61823
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IF4A1_HUMAN \| P60842	:	2g9n 2zu6
	PDCD4_MOUSE \| Q61823	:	2hm8 2iol 2ion 2ios 2kzt 2nsz

(no "Related Entries Specified in the PDB File" available for 3EIQ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (15, 15)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Exons (10, 20)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (37, 42)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File