2KZT - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   STRUCTURE OF THE TANDEM MA-3 REGION OF PDCD4

Authors :   L. C. Waters, S. L. Strong, O. Oka, F. W. Muskett, V. Veverka, S. Banerjee T. Schmedt, A. J. Henry, K. H. Klempnauer, M. D. Carr

Date :   24 Jun 10 (Deposition) - 16 Mar 11 (Release) - 23 Nov 11 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A,B  (73x)
NMR Structure *: A,B  (1x)

Keywords :   Pdcd4, Ma-3, Eif4A, Heat, Apoptosis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   L. C. Waters, S. L. Strong, E. Ferlemann, O. Oka, F. W. Muskett, V. Veverka, S. Banerjee, T. Schmedt, A. J. Henry, K. H. Klempnauer, M. D. Carr
Structure Of The Tandem Ma-3 Region Of Pdcd4 Protein And Characterization Of Its Interactions With Eif4A And Eif4G: Molecular Mechanisms Of A Tumor Suppressor
J. Biol. Chem. V. 286 17270 2011
PubMed-ID: 21454508 | Reference-DOI: 10.1074/JBC.M110.166157

Molecule 1 - PROGRAMMED CELL DEATH PROTEIN 4
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PGEX-6P-2
	Expression System Vector Type	:	VECTOR
	Fragment	:	MA-3 REGION, RESIDUES 157-318
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PDCD4, NUCLEAR ANTIGEN H731-LIKE, NEOPLASTIC TRANSFORMATION INHIBITOR PROTEIN, PROTEIN 197/15A

Molecule 2 - PROGRAMMED CELL DEATH PROTEIN 4
	Chains	:	B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector	:	PGEX-6P-2
	Expression System Vector Type	:	VECTOR
	Fragment	:	MA-3 REGION, RESIDUES 319-449
	Organism Common	:	MOUSE
	Organism Scientific	:	MUS MUSCULUS
	Organism Taxid	:	10090
	Synonym	:	PDCD4, TOPOISOMERASE-INHIBITOR SUPPRESSED PROTEIN, PROTEIN MA-3

		1	2
NMR Structure (73x)	:	A	B
NMR Structure * (1x)	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2KZT)

(no "Site" information available for 2KZT)

(no "SS Bond" information available for 2KZT)

(no "Cis Peptide Bond" information available for 2KZT)

(no "SAP(SNP)/Variant" information available for 2KZT)

NMR Structure (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MI	PS51366	MI domain profile.	PDCD4_HUMAN	163-284 326-449	1	A:163-284 -
1	MI	PS51366	MI domain profile.	PDCD4_MOUSE	163-284 326-449	1	- B:326-449

NMR Structure * (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	MI	PS51366	MI domain profile.	PDCD4_HUMAN	163-284 326-449	1	A:163-284 -
1	MI	PS51366	MI domain profile.	PDCD4_MOUSE	163-284 326-449	1	- B:326-449

NMR Structure (4, 4)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000280154	1a	ENSE00001922986	chr10:112631565-112631776	212	PDCD4_HUMAN	-	0	0	-	-
1.2	ENST00000280154	2	ENSE00002190882	chr10:112635724-112635828	105	PDCD4_HUMAN	1-15	15	0	-	-
1.6a	ENST00000280154	6a	ENSE00001380538	chr10:112640991-112641293	303	PDCD4_HUMAN	15-116	102	0	-	-
1.7	ENST00000280154	7	ENSE00000995567	chr10:112642761-112642855	95	PDCD4_HUMAN	116-147	32	0	-	-
1.8c	ENST00000280154	8c	ENSE00001094657	chr10:112645011-112645124	114	PDCD4_HUMAN	148-185	38	1	A:156-185	30
1.9e	ENST00000280154	9e	ENSE00002200197	chr10:112647423-112647644	222	PDCD4_HUMAN	186-259	74	1	A:186-259	74
1.10	ENST00000280154	10	ENSE00001788034	chr10:112649291-112649388	98	PDCD4_HUMAN	260-292	33	1	A:260-292	33
1.11a	ENST00000280154	11a	ENSE00001772839	chr10:112650314-112650428	115	PDCD4_HUMAN	292-330	39	1	A:292-318	27
1.12b	ENST00000280154	12b	ENSE00001599108	chr10:112653849-112653956	108	PDCD4_HUMAN	331-366	36	0	-	-
1.13	ENST00000280154	13	ENSE00001674744	chr10:112654170-112654280	111	PDCD4_HUMAN	367-403	37	0	-	-
1.14b	ENST00000280154	14b	ENSE00001636249	chr10:112655706-112655845	140	PDCD4_HUMAN	404-450	47	0	-	-
1.15e	ENST00000280154	15e	ENSE00001840051	chr10:112657786-112659764	1979	PDCD4_HUMAN	450-469	20	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:163
 aligned with PDCD4_HUMAN | Q53EL6 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:163
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315   
          PDCD4_HUMAN   156 VLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSG 318
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------MA3-2kztA01 A:164-275                                                                                           ------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh....hhhhhh.....hhhhhhhhhhhhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------MI  PDB: A:163-284 UniProt: 163-284                                                                                       ---------------------------------- PROSITE
           Transcript 1 (1) Exon 1.8c  PDB: A:156-185     Exon 1.9e  PDB: A:186-259 UniProt: 186-259                                Exon 1.10  PDB: A:260-292        -------------------------- Transcript 1 (1)
           Transcript 1 (2) ----------------------------------------------------------------------------------------------------------------------------------------Exon 1.11a  PDB: A:292-318  Transcript 1 (2)
                 2kzt A 156 GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSG 318
                                   165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315

Chain B from PDB  Type:PROTEIN  Length:131
 aligned with PDCD4_MOUSE | Q61823 from UniProtKB/Swiss-Prot  Length:469

    Alignment length:131
                                   328       338       348       358       368       378       388       398       408       418       428       438       448 
          PDCD4_MOUSE   319 GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS 449
               SCOP domains d2kztb_ B: automated matches                                                                                                        SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------MA3-2kztB01 B:327-440                                                                                             --------- Pfam domains
         Sec.struct. author ...........hhhhhhhhhhh..hhhhhhhhhh....hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhh..hhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (1) -------MI  PDB: B:326-449 UniProt: 326-449                                                                                          PROSITE (1)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2kzt B 319 GGQQPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPS 449
                                   328       338       348       358       368       378       388       398       408       418       428       438       448

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

NMR Structure

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: alpha-alpha superhelix (690)

Superfamily: ARM repeat (317)

Family: MIF4G domain-like (17)

Protein domain: automated matches (2)

Mouse (Mus musculus) [TaxId: 10090] (1)

d2kztb_

(no "CATH Domain" information available for 2KZT)

NMR Structure

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TPR (230)

Family: MA3 (5)

Homo sapiens (Human) (5)

MA3-2kztA01

A:164-275

Mus musculus (Mouse) (1)

MA3-2kztB01

B:327-440

NMR Structure(hide GO term definitions)

Chain A (PDCD4_HUMAN | Q53EL6)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007569	cell aging	An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
	GO:0043508	negative regulation of JUN kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of JUN kinase activity.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0045786	negative regulation of cell cycle	Any process that stops, prevents or reduces the rate or extent of progression through the cell cycle.
	GO:1904761	negative regulation of myofibroblast differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of myofibroblast differentiation.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0051246	regulation of protein metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B (PDCD4_MOUSE | Q61823)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0007569	cell aging	An aging process that has as participant a cell after a cell has stopped dividing. Cell aging may occur when a cell has temporarily stopped dividing through cell cycle arrest (GO:0007050) or when a cell has permanently stopped dividing, in which case it is undergoing cellular senescence (GO:0090398). May precede cell death (GO:0008219) and succeed cell maturation (GO:0048469).
	GO:0043508	negative regulation of JUN kinase activity	Any process that stops, prevents, or reduces the frequency, rate or extent of JUN kinase activity.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:1904761	negative regulation of myofibroblast differentiation	Any process that stops, prevents or reduces the frequency, rate or extent of myofibroblast differentiation.
	GO:0045892	negative regulation of transcription, DNA-templated	Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0034393	positive regulation of smooth muscle cell apoptotic process	Any process that activates or increases the frequency, rate, or extent of smooth muscle cell apoptotic process.
	GO:0051246	regulation of protein metabolic process	Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving a protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2kzt)

	Sites
(no "Sites" information available for 2kzt)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2kzt)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2kzt
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PDCD4_HUMAN \| Q53EL6
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PDCD4_MOUSE \| Q61823
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PDCD4_HUMAN \| Q53EL6
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PDCD4_MOUSE \| Q61823
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PDCD4_HUMAN \| Q53EL6	:	2ggf 2rg8 2zu6 3eij
	PDCD4_MOUSE \| Q61823	:	2hm8 2iol 2ion 2ios 2nsz 3eiq

(no "Related Entries Specified in the PDB File" available for 2KZT)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (4, 4)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (0, 0)

Pfam Domains (2, 2)

Gene Ontology (15, 29)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File