![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 4)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 3CYT) |
(no "Cis Peptide Bond" information available for 3CYT) |
(no "SAP(SNP)/Variant" information available for 3CYT) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 3CYT) |
Asymmetric UnitChain I from PDB Type:PROTEIN Length:104 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:104 1 | 9 19 29 39 49 59 69 79 89 99 CYC_THUAA - -GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d3cyti_ I: Mitochondrial cytochrome c SCOP domains CATH domains -3cytI00 I:1-103 Cytochrome c CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTC PDB: I:1-102 UniProt: 1-102 - PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 3cyt I 0 xGDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 | 9 19 29 39 49 59 69 79 89 99 | 0-ACE Chain O from PDB Type:PROTEIN Length:104 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:104 1 | 9 19 29 39 49 59 69 79 89 99 CYC_THUAA - -GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d3cyto_ O: Mitochondrial cytochrome c SCOP domains CATH domains -3cytO00 O:1-103 Cytochrome c CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -CYTC PDB: O:1-102 UniProt: 1-102 - PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 3cyt O 0 xGDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 | 9 19 29 39 49 59 69 79 89 99 0-ACE
|
Asymmetric Unit |
Asymmetric Unit |
(no "Pfam Domain" information available for 3CYT) |
Asymmetric Unit(hide GO term definitions) Chain I,O (CYC_THUAA | P81459)
|
|
|
|
|
|
|