|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)
Asymmetric Unit (2, 4)
|
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1I55) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1I55) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1I55) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1I55) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:103 10 20 30 40 50 60 70 80 90 100 CYC_THUAA 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d1i55a_ A: Mitochondrial cytochrome c SCOP domains CATH domains 1i55A00 A:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: A:1-102 UniProt: 1-102 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1i55 A 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:103 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot Length:103 Alignment length:103 10 20 30 40 50 60 70 80 90 100 CYC_THUAA 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 SCOP domains d1i55b_ B: Mitochondrial cytochrome c SCOP domains CATH domains 1i55B00 B:1-103 Cytochrome c CATH domains Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CYTC PDB: B:1-102 UniProt: 1-102 - PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1i55 B 1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1I55) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (CYC_THUAA | P81459)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|