1I54 - JenaLib

Title :   CYTOCHROME C (TUNA) 2FE:1ZN MIXED-METAL PORPHYRINS

Authors :   B. R. Crane, F. A. Tezcan, J. R. Winkler, H. B. Gray

Date :   24 Feb 01 (Deposition) - 09 May 01 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Cytochrome C, Zinc-Porphyrin, Mixed-Metal, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   F. A. Tezcan, B. R. Crane, J. R. Winkler, H. B. Gray
Electron Tunneling In Protein Crystals.
Proc. Natl. Acad. Sci. Usa V. 98 5002 2001
PubMed-ID: 11296248 | Reference-DOI: 10.1073/PNAS.081072898
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 4)

Sites (4, 4)

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:13 , CYS A:14 , CYS A:17 , HIS A:18 , VAL A:28 , GLY A:29 , PRO A:30 , THR A:40 , GLY A:41 , TYR A:46 , TYR A:48 , THR A:49 , ASN A:52 , LYS A:55 , TRP A:59 , TYR A:67 , THR A:78 , LYS A:79 , MET A:80 , PHE A:82 , LEU A:94 , HOH A:1127	BINDING SITE FOR RESIDUE HEM A 1104
2	AC2	SOFTWARE	LYS B:13 , CYS B:14 , CYS B:17 , HIS B:18 , VAL B:28 , GLY B:29 , PRO B:30 , THR B:40 , GLY B:41 , TYR B:46 , TYR B:48 , THR B:49 , ASN B:52 , LYS B:55 , TRP B:59 , TYR B:67 , THR B:78 , LYS B:79 , MET B:80 , PHE B:82 , HOH B:1144	BINDING SITE FOR RESIDUE HEM B 1106
3	AC3	SOFTWARE	LYS A:13 , CYS A:14 , CYS A:17 , HIS A:18 , VAL A:28 , GLY A:29 , PRO A:30 , THR A:40 , GLY A:41 , TYR A:46 , TYR A:48 , THR A:49 , ASN A:52 , LYS A:55 , TRP A:59 , TYR A:67 , THR A:78 , LYS A:79 , MET A:80 , PHE A:82 , HOH A:1127	BINDING SITE FOR RESIDUE ZNH A 1105
4	AC4	SOFTWARE	LYS B:13 , CYS B:14 , CYS B:17 , HIS B:18 , VAL B:28 , GLY B:29 , PRO B:30 , THR B:40 , GLY B:41 , TYR B:46 , TYR B:48 , THR B:49 , ASN B:52 , LYS B:55 , TRP B:59 , TYR B:67 , THR B:78 , LYS B:79 , MET B:80 , PHE B:82 , HOH B:1144	BINDING SITE FOR RESIDUE ZNH B 1107

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:103
 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
            CYC_THUAA     1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103
               SCOP domains d1i54a_ A: Mitochondrial cytochrome c                                                                   SCOP domains
               CATH domains 1i54A00 A:1-103 Cytochrome c                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: A:1-102 UniProt: 1-102                                                                     - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1i54 A   1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103
                                    10        20        30        40        50        60        70        80        90       100

Chain B from PDB  Type:PROTEIN  Length:103
 aligned with CYC_THUAA | P81459 from UniProtKB/Swiss-Prot  Length:103

    Alignment length:103
                                    10        20        30        40        50        60        70        80        90       100   
            CYC_THUAA     1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103
               SCOP domains d1i54b_ B: Mitochondrial cytochrome c                                                                   SCOP domains
               CATH domains 1i54B00 B:1-103 Cytochrome c                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhh..................................hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE CYTC  PDB: B:1-102 UniProt: 1-102                                                                     - PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1i54 B   1 GDVAKGKKTFVQKCAQCHTVENGGKHKVGPNLWGLFGRKTGQAEGYSYTDANKSKGIVWNNDTLMEYLENPKKYIPGTKMIFAGIKKKGERQDLVAYLKSATS 103
                                    10        20        30        40        50        60        70        80        90       100

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Asymmetric Unit(hide GO term definitions)

Chain A,B (CYC_THUAA | P81459)

molecular function
	GO:0009055	electron carrier activity	Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
	GO:0020037	heme binding	Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005758	mitochondrial intermembrane space	The region between the inner and outer lipid bilayers of the mitochondrial envelope.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0070469	respiratory chain	The protein complexes that form the electron transport system (the respiratory chain), associated with a cell membrane, usually the plasma membrane (in prokaryotes) or the inner mitochondrial membrane (on eukaryotes). The respiratory chain complexes transfer electrons from an electron donor to an electron acceptor and are associated with a proton pump to create a transmembrane electrochemical gradient.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		ZNH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1i54)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1i54
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CYC_THUAA \| P81459
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description