|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
Asymmetric Unit (1, 2)
|
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3CVB) |
Cis Peptide Bonds (4, 4)
Asymmetric Unit
|
||||||||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3CVB) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 3CVB) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:105 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:105 44 54 64 74 84 94 104 114 124 134 PLAS_PHOLA 35 ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d3cvba_ A: Plastocyanin SCOP domains CATH domains 3cvbA00 A:1-105 Cupredoxins - blue copper proteins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 3cvb A 1 ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:105 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:105 44 54 64 74 84 94 104 114 124 134 PLAS_PHOLA 35 ETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d3cvbb_ B: Plastocyanin SCOP domains CATH domains 3cvbB00 B:1-105 Cupredoxins - blue copper proteins CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 3cvb B 1 ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3CVB) |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (PLAS_PHOLA | Q51883)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|