|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 6) Biological Unit 1 (0, 0) Biological Unit 2 (0, 0) Biological Unit 3 (0, 0) |
Asymmetric Unit (6, 6)
|
(no "SS Bond" information available for 2W8C) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2W8C) |
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 2W8C) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:106 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:106 43 53 63 73 83 93 103 113 123 133 PLAS_PHOLA 34 AETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d2w8ca_ A: Plastocyanin SCOP domains CATH domains 2w8cA00 A:0-105 Cupredoxins - blue copper proteins CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2w8c A 0 METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 9 19 29 39 49 59 69 79 89 99 Chain B from PDB Type:PROTEIN Length:106 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:106 43 53 63 73 83 93 103 113 123 133 PLAS_PHOLA 34 AETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d2w8cb_ B: Plastocyanin SCOP domains CATH domains 2w8cB00 B:0-105 Cupredoxins - blue copper proteins CATH domains Pfam domains (1) ---Copper-bind-2w8cB01 B:3-104 - Pfam domains (1) Pfam domains (2) ---Copper-bind-2w8cB02 B:3-104 - Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2w8c B 0 METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 9 19 29 39 49 59 69 79 89 99
|
Asymmetric Unit
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (PLAS_PHOLA | Q51883)
|
|
|
|
|
|
|