|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 6)| Asymmetric Unit (2, 6) Biological Unit 1 (0, 0) Biological Unit 2 (0, 0) Biological Unit 3 (0, 0) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2W8C) |
Cis Peptide Bonds (4, 4)
Asymmetric Unit
|
||||||||||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2W8C) |
PROSITE Motifs (1, 2)
Asymmetric Unit (1, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2W8C) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:106 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:106 43 53 63 73 83 93 103 113 123 133 PLAS_PHOLA 34 AETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d2w8ca_ A: Plastocyanin SCOP domains CATH domains 2w8cA00 A:0-105 Cupredoxins - blue copper proteins CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2w8c A 0 METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 9 19 29 39 49 59 69 79 89 99 Chain B from PDB Type:PROTEIN Length:106 aligned with PLAS_PHOLA | Q51883 from UniProtKB/Swiss-Prot Length:139 Alignment length:106 43 53 63 73 83 93 103 113 123 133 PLAS_PHOLA 34 AETFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 139 SCOP domains d2w8cb_ B: Plastocyanin SCOP domains CATH domains 2w8cB00 B:0-105 Cupredoxins - blue copper proteins CATH domains Pfam domains (1) ---Copper-bind-2w8cB01 B:3-104 - Pfam domains (1) Pfam domains (2) ---Copper-bind-2w8cB02 B:3-104 - Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------COPPER_BLUE -------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------- Transcript 2w8c B 0 METFTVKMGADSGLLQFEPANVTVHPGDTVKWVNNKLPPHNILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDFPAGTYTYYCAPHRGAGMVGKITVEG 105 9 19 29 39 49 59 69 79 89 99
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A,B (PLAS_PHOLA | Q51883)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|