3AAD - JenaLib

Asymmetric/Biological Unit (13, 17)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000229595	1a	ENSE00002043177	chr6:119215384-119215686	303	ASF1A_HUMAN	1-37	37	2	B:1-37 D:1-37	37 37
1.2b	ENST00000229595	2b	ENSE00002082499	chr6:119221931-119222046	116	ASF1A_HUMAN	37-75	39	2	B:37-75 D:37-75	39 39
1.3	ENST00000229595	3	ENSE00000762824	chr6:119226817-119226993	177	ASF1A_HUMAN	76-134	59	2	B:76-134 D:76-134	59 59
1.4	ENST00000229595	4	ENSE00001295367	chr6:119228567-119230332	1766	ASF1A_HUMAN	135-204	70	2	B:135-153 D:135-152	19 18

2.1a	ENST00000373790	1a	ENSE00002190552	X:70586114-70586344	231	TAF1_HUMAN	1-60	60	0	-	-
2.2	ENST00000373790	2	ENSE00001693606	X:70587349-70587463	115	TAF1_HUMAN	61-99	39	0	-	-
2.3	ENST00000373790	3	ENSE00001806491	X:70587904-70588020	117	TAF1_HUMAN	99-138	40	0	-	-
2.4	ENST00000373790	4	ENSE00001762844	X:70595017-70595136	120	TAF1_HUMAN	138-178	41	0	-	-
2.5c	ENST00000373790	5c	ENSE00001746797	X:70596863-70597041	179	TAF1_HUMAN	178-237	60	0	-	-
2.6a	ENST00000373790	6a	ENSE00001657433	X:70597453-70597671	219	TAF1_HUMAN	238-310	73	0	-	-
2.7	ENST00000373790	7	ENSE00001610045	X:70598085-70598303	219	TAF1_HUMAN	311-383	73	0	-	-
2.8	ENST00000373790	8	ENSE00001671320	X:70598674-70598881	208	TAF1_HUMAN	384-453	70	0	-	-
2.9	ENST00000373790	9	ENSE00001748084	X:70601593-70601769	177	TAF1_HUMAN	453-512	60	0	-	-
2.10	ENST00000373790	10	ENSE00001728655	X:70602386-70602513	128	TAF1_HUMAN	512-554	43	0	-	-
2.11	ENST00000373790	11	ENSE00001606772	X:70602611-70602718	108	TAF1_HUMAN	555-590	36	0	-	-
2.12	ENST00000373790	12	ENSE00001621948	X:70602841-70603014	174	TAF1_HUMAN	591-648	58	0	-	-
2.13	ENST00000373790	13	ENSE00001801775	X:70603812-70603985	174	TAF1_HUMAN	649-706	58	0	-	-
2.14	ENST00000373790	14	ENSE00001788701	X:70604795-70604899	105	TAF1_HUMAN	707-741	35	0	-	-
2.15b	ENST00000373790	15b	ENSE00001684911	X:70607111-70607311	201	TAF1_HUMAN	742-808	67	0	-	-
2.16b	ENST00000373790	16b	ENSE00001718382	X:70608087-70608228	142	TAF1_HUMAN	809-856	48	0	-	-
2.17b	ENST00000373790	17b	ENSE00001675273	X:70608588-70608718	131	TAF1_HUMAN	856-899	44	0	-	-
2.18b	ENST00000373790	18b	ENSE00001762617	X:70609435-70609515	81	TAF1_HUMAN	900-926	27	0	-	-
2.19	ENST00000373790	19	ENSE00001781380	X:70612419-70612568	150	TAF1_HUMAN	927-976	50	0	-	-
2.20	ENST00000373790	20	ENSE00001663592	X:70612725-70612844	120	TAF1_HUMAN	977-1016	40	0	-	-
2.21	ENST00000373790	21	ENSE00001765081	X:70613151-70613326	176	TAF1_HUMAN	1017-1075	59	0	-	-
2.22a	ENST00000373790	22a	ENSE00001687499	X:70613917-70614095	179	TAF1_HUMAN	1075-1135	61	0	-	-
2.23a	ENST00000373790	23a	ENSE00001652592	X:70617103-70617316	214	TAF1_HUMAN	1135-1206	72	0	-	-
2.24	ENST00000373790	24	ENSE00001801856	X:70618422-70618587	166	TAF1_HUMAN	1206-1261	56	0	-	-
2.25	ENST00000373790	25	ENSE00001592652	X:70621378-70621589	212	TAF1_HUMAN	1262-1332	71	0	-	-
2.26a	ENST00000373790	26a	ENSE00002178934	X:70626488-70626596	109	TAF1_HUMAN	1332-1368	37	1	A:1353-1366	14
2.27	ENST00000373790	27	ENSE00001710784	X:70627424-70627522	99	TAF1_HUMAN	1369-1401	33	1	A:1379-1401	23
2.28	ENST00000373790	28	ENSE00001716532	X:70627824-70628001	178	TAF1_HUMAN	1402-1461	60	1	A:1402-1461	60
2.30	ENST00000373790	30	ENSE00001598091	X:70641159-70641226	68	TAF1_HUMAN	1461-1483	23	1	A:1461-1483	23
2.31a	ENST00000373790	31a	ENSE00000978923	X:70642967-70643089	123	TAF1_HUMAN	1484-1524	41	1	A:1484-1524	41
2.32a	ENST00000373790	32a	ENSE00001688409	X:70643824-70643916	93	TAF1_HUMAN	1525-1555	31	1	A:1525-1555	31
2.33	ENST00000373790	33	ENSE00001733084	X:70644004-70644088	85	TAF1_HUMAN	1556-1584	29	1	A:1556-1584	29
2.35	ENST00000373790	35	ENSE00001619905	X:70674020-70674087	68	TAF1_HUMAN	1584-1606	23	1	A:1584-1606	23
2.36	ENST00000373790	36	ENSE00001702834	X:70674591-70674707	117	TAF1_HUMAN	1607-1645	39	1	A:1607-1628	22
2.38b	ENST00000373790	38b	ENSE00001803182	X:70678091-70678216	126	TAF1_HUMAN	1646-1687	42	0	-	-
2.40a	ENST00000373790	40a	ENSE00001787591	X:70679402-70679558	157	TAF1_HUMAN	1688-1740	53	0	-	-
2.41a	ENST00000373790	41a	ENSE00001689245	X:70680476-70680653	178	TAF1_HUMAN	1740-1799	60	0	-	-
2.42e	ENST00000373790	42e	ENSE00001942720	X:70683674-70685855	2182	TAF1_HUMAN	1799-1872	74	0	-	-

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:264
 aligned with TAF1_HUMAN | P21675 from UniProtKB/Swiss-Prot  Length:1872

    Alignment length:276
                                  1362      1372      1382      1392      1402      1412      1422      1432      1442      1452      1462      1472      1482      1492      1502      1512      1522      1532      1542      1552      1562      1572      1582      1592      1602      1612      1622      
          TAF1_HUMAN   1353 KKKRRVGTTVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEE 1628
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 3aadA01       ------------3aadA02 A:1379-1495 Histone Acetyltransferase; Chain A                                                               3aadA01 A:1353-1366,A:1496-1628 Histone Acetyltransferase; Chain A                                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..............------------.hhhhhhhhhhhhhhhhhh....hhhhh.........hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh...hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh..hhhhh.........hhhhhh....hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------I-----------------------------------------------H----------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) --------------------------------------------BROMODOMAIN_2  PDB: A:1397-1467 UniProt: 1397-1467                     ----------------------------------------------------BROMODOMAIN_2  PDB: A:1520-1590 UniProt: 1520-1590                     -------------------------------------- PROSITE (1)
                PROSITE (2) -------------------------------------------------BROMODOMAIN_1  PDB: A:1402-1459 UniProt: 1402-1459        -----------------------------------------------------------------BROMODOMAIN_1  PDB: A:1525-1582 UniProt: 1525-1582        ---------------------------------------------- PROSITE (2)
           Transcript 2 (1) Exon 2.26a      Exon 2.27  PDB: A:1379-1401      Exon 2.28  PDB: A:1402-1461 UniProt: 1402-1461              ----------------------Exon 2.31a  PDB: A:1484-1524             Exon 2.32a  PDB: A:1525-1555   Exon 2.33  PDB: A:1556-1584  ----------------------Exon 2.36 [INCOMPLETE] Transcript 2 (1)
           Transcript 2 (2) ------------------------------------------------------------------------------------------------------------Exon 2.30              ----------------------------------------------------------------------------------------------------Exon 2.35              ---------------------- Transcript 2 (2)
                3aad A 1353 KKKRRVGTTVHCDY------------TDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDICTAKEAALEE 1628
                                  1362   |     -      1382      1392      1402      1412      1422      1432      1442      1452      1462      1472      1482      1492      1502      1512      1522      1532      1542      1552      1562      1572      1582      1592      1602      1612      1622      
                                      1366         1379

Chain B from PDB  Type:PROTEIN  Length:153
 aligned with ASF1A_HUMAN | Q9Y294 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:153
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150   
         ASF1A_HUMAN      1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW  153
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3aadB00 B:1-153 ASF1-like                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee.......ee....eeeeeeeee.........eeeeee.........eeeeee.......eeeeeeeee...hhhhh.......eeeeeeeeee..eeeeeeeeeeeeee.............hhh.eeeee.....eeee..... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:1-37 UniProt: 1-37 --------------------------------------Exon 1.3  PDB: B:76-134 UniProt: 76-134                    Exon 1.4            Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2b  PDB: B:37-75 UniProt: 37-75 ------------------------------------------------------------------------------ Transcript 1 (2)
                3aad B    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHINW  153
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Chain D from PDB  Type:PROTEIN  Length:152
 aligned with ASF1A_HUMAN | Q9Y294 from UniProtKB/Swiss-Prot  Length:204

    Alignment length:152
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150  
         ASF1A_HUMAN      1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHIN  152
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 3aadD00 D:1-152 ASF1-like                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee.........ee....eee..eeee........eeeeee..........eeeeee.......eeee..eee...hhhhh......eeeeeeeeeee..eeeeeeeeeeeeee.................eeeee.....eee..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: D:1-37 UniProt: 1-37 --------------------------------------Exon 1.3  PDB: D:76-134 UniProt: 76-134                    Exon 1.4           Transcript 1 (1)
           Transcript 1 (2) ------------------------------------Exon 1.2b  PDB: D:37-75 UniProt: 37-75 ----------------------------------------------------------------------------- Transcript 1 (2)
                3aad D    1 MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPVKPDFSKLQRNILASNPRVTRFHIN  152
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (51, 56)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (TAF1_HUMAN | P21675)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0003677	DNA binding	Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
	GO:0017025	TBP-class protein binding	Interacting selectively and non-covalently with a member of the class of TATA-binding proteins (TBP), including any of the TBP-related factors (TRFs).
	GO:0004402	histone acetyltransferase activity	Catalysis of the reaction: acetyl-CoA + histone = CoA + acetyl-histone.
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0070577	lysine-acetylated histone binding	Interacting selectively and non-covalently with a histone in which a lysine residue has been modified by acetylation.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0002039	p53 binding	Interacting selectively and non-covalently with one of the p53 family of proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0043565	sequence-specific DNA binding	Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
	GO:0003713	transcription coactivator activity	Interacting selectively and non-covalently with a activating transcription factor and also with the basal transcription machinery in order to increase the frequency, rate or extent of transcription. Cofactors generally do not bind the template nucleic acid, but rather mediate protein-protein interactions between activating transcription factors and the basal transcription machinery.
	GO:0008134	transcription factor binding	Interacting selectively and non-covalently with a transcription factor, any protein required to initiate or regulate transcription.
	GO:0044212	transcription regulatory region DNA binding	Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
	GO:0016746	transferase activity, transferring acyl groups	Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
	GO:0006352	DNA-templated transcription, initiation	Any process involved in the assembly of the RNA polymerase preinitiation complex (PIC) at the core promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. The initiation phase ends just before and does not include promoter clearance, or release, which is the transition between the initiation and elongation phases of transcription.
	GO:0051123	RNA polymerase II transcriptional preinitiation complex assembly	The aggregation, arrangement and bonding together of proteins on an RNA polymerase II promoter DNA to form the transcriptional preinitiation complex (PIC), the formation of which is a prerequisite for transcription by RNA polymerase.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0016573	histone acetylation	The modification of a histone by the addition of an acetyl group.
	GO:0018105	peptidyl-serine phosphorylation	The phosphorylation of peptidyl-serine to form peptidyl-O-phospho-L-serine.
	GO:0018107	peptidyl-threonine phosphorylation	The phosphorylation of peptidyl-threonine to form peptidyl-O-phospho-L-threonine.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	Any process that activates or increases the frequency, rate or extent of the breakdown of a protein or peptide by hydrolysis of its peptide bonds, initiated by the covalent attachment of ubiquitin, and mediated by the proteasome.
	GO:0045944	positive regulation of transcription from RNA polymerase II promoter	Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	Any process that increases the rate, frequency or extent of a process involved in starting transcription from an RNA polymerase II promoter.
	GO:0046777	protein autophosphorylation	The phosphorylation by a protein of one or more of its own amino acid residues (cis-autophosphorylation), or residues on an identical protein (trans-autophosphorylation).
	GO:1901796	regulation of signal transduction by p53 class mediator	Any process that modulates the frequency, rate or extent of signal transduction by p53 class mediator.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006368	transcription elongation from RNA polymerase II promoter	The extension of an RNA molecule after transcription initiation and promoter clearance at an RNA polymerase II promoter by the addition of ribonucleotides catalyzed by RNA polymerase II.
	GO:0006366	transcription from RNA polymerase II promoter	The synthesis of RNA from a DNA template by RNA polymerase II, originating at an RNA polymerase II promoter. Includes transcription of messenger RNA (mRNA) and certain small nuclear RNAs (snRNAs).
	GO:0006367	transcription initiation from RNA polymerase II promoter	Any process involved in the assembly of the RNA polymerase II preinitiation complex (PIC) at an RNA polymerase II promoter region of a DNA template, resulting in the subsequent synthesis of RNA from that promoter. The initiation phase includes PIC assembly and the formation of the first few bonds in the RNA chain, including abortive initiation, which occurs when the first few nucleotides are repeatedly synthesized and then released. Promoter clearance, or release, is the transition between the initiation and elongation phases of transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0071339	MLL1 complex	A protein complex that can methylate lysine-4 of histone H3. MLL1/MLL is the catalytic methyltransferase subunit, and the complex also contains the core components ASH2L, HCFC1/HCF1 WDR5 and RBBP5.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005669	transcription factor TFIID complex	A complex composed of TATA binding protein (TBP) and TBP associated factors (TAFs); the total mass is typically about 800 kDa. Most of the TAFs are conserved across species. In TATA-containing promoters for RNA polymerase II (Pol II), TFIID is believed to recognize at least two distinct elements, the TATA element and a downstream promoter element. TFIID is also involved in recognition of TATA-less Pol II promoters. Binding of TFIID to DNA is necessary but not sufficient for transcription initiation from most RNA polymerase II promoters.

Chain B,D (ASF1A_HUMAN | Q9Y294)

molecular function
	GO:0003682	chromatin binding	Interacting selectively and non-covalently with chromatin, the network of fibers of DNA, protein, and sometimes RNA, that make up the chromosomes of the eukaryotic nucleus during interphase.
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006281	DNA repair	The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
	GO:0006335	DNA replication-dependent nucleosome assembly	The formation of nucleosomes on newly replicated DNA, coupled to strand elongation.
	GO:0006336	DNA replication-independent nucleosome assembly	The formation of nucleosomes outside the context of DNA replication.
	GO:0006333	chromatin assembly or disassembly	The formation or destruction of chromatin structures.
	GO:0042692	muscle cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a muscle cell.
	GO:0031936	negative regulation of chromatin silencing	Any process that stops, prevents, or reduces the frequency, rate or extent of chromatin silencing.
	GO:0006334	nucleosome assembly	The aggregation, arrangement and bonding together of a nucleosome, the beadlike structural units of eukaryotic chromatin composed of histones and DNA.
	GO:0001649	osteoblast differentiation	The process whereby a relatively unspecialized cell acquires the specialized features of an osteoblast, a mesodermal or neural crest cell that gives rise to bone.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0000790	nuclear chromatin	The ordered and organized complex of DNA, protein, and sometimes RNA, that forms the chromosome in the nucleus.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0043234	protein complex	A stable macromolecular complex composed (only) of two or more polypeptide subunits along with any covalently attached molecules (such as lipid anchors or oligosaccharide) or non-protein prosthetic groups (such as nucleotides or metal ions). Prosthetic group in this context refers to a tightly bound cofactor. The component polypeptide subunits may be identical.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (1, 1)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (2, 4)

Exons (13, 17)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (2, 4)

Pfam Domains (0, 0)

Gene Ontology (51, 56)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File