|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric/Biological Unit (3, 5) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3A38) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3A38) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3A38) |
PROSITE Motifs (1, 1)| Asymmetric/Biological Unit (1, 1) |
Exons (0, 0)| (no "Exon" information available for 3A38) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:83 aligned with HIP_THETI | P80176 from UniProtKB/Swiss-Prot Length:83 Alignment length:83 10 20 30 40 50 60 70 80 HIP_THETI 1 AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG 83 SCOP domains d3a38a_ A: HIPIP (high potential iron protein) SCOP domains CATH domains 3a38A00 A:1-83 High-Potential Iron-Sulfur Protein, subunit A CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE HIPIP PDB: A:1-83 UniProt: 1-83 PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 3a38 A 1 AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG 83 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3A38) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (HIP_THETI | P80176)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|