5WQR - JenaLib

Title :   HIGH RESOLUTION STRUCTURE OF HIGH-POTENTIAL IRON-SULFUR PROTEIN IN THE REDUCED STATE

Authors :   H. Ohno, K. Takeda, S. Niwa, T. Tsujinaka, Y. Hanazono, Y. Hirano, K. Mik

Date :   28 Nov 16 (Deposition) - 07 Jun 17 (Release) - 07 Jun 17 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   0.80

Chains :   Asym./Biol. Unit : A

Keywords :   Iron-Sulfur Protein, Metal-Binding Protein, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Ohno, K. Takeda, S. Niwa, T. Tsujinaka, Y. Hanazono, Y. Hirano, K. Miki
Crystallographic Characterization Of The High-Potential Iron-Sulfur Protein In The Oxidized State At 0. 8 Angstrom Resolution
Plos One V. 12 78183 2017
PubMed-ID: 28542634 | Reference-DOI: 10.1371/JOURNAL.PONE.0178183

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 9)

Sites (9, 9)

Asymmetric Unit (9, 9)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:19 , CYS A:43 , CYS A:46 , CYS A:61 , LEU A:63 , CYS A:75	binding site for residue SF4 A 101
2	AC2	SOFTWARE	LYS A:18 , GLY A:54 , GLU A:55 , GLY A:56 , LYS A:59 , GOL A:108 , GOL A:109 , HOH A:206 , HOH A:261 , HOH A:275 , HOH A:321	binding site for residue SO4 A 102
3	AC3	SOFTWARE	GLN A:50 , ALA A:51 , ASN A:52 , GOL A:109 , HOH A:204 , HOH A:210 , HOH A:234 , HOH A:273 , HOH A:285	binding site for residue SO4 A 103
4	AC4	SOFTWARE	HIS A:42 , GLN A:50 , GLN A:62 , GOL A:107 , HOH A:203 , HOH A:215 , HOH A:219 , HOH A:241 , HOH A:261 , HOH A:269 , HOH A:274	binding site for residue SO4 A 104
5	AC5	SOFTWARE	ALA A:6 , VAL A:7 , THR A:8 , ASP A:11 , LYS A:25 , LYS A:67 , HOH A:208 , HOH A:209 , HOH A:221 , HOH A:262 , HOH A:283 , HOH A:289	binding site for residue SO4 A 105
6	AC6	SOFTWARE	ALA A:1 , ALA A:2 , HOH A:205 , HOH A:209 , HOH A:221 , HOH A:227 , HOH A:236 , HOH A:283 , HOH A:299 , HOH A:311	binding site for residue SO4 A 106
7	AC7	SOFTWARE	LYS A:18 , GLU A:27 , ASN A:45 , GLN A:62 , SO4 A:104 , GOL A:108 , HOH A:203 , HOH A:263 , HOH A:338	binding site for residue GOL A 107
8	AC8	SOFTWARE	ILE A:15 , GLN A:47 , GLN A:50 , GLN A:62 , SO4 A:102 , GOL A:107 , GOL A:109 , HOH A:218 , HOH A:228 , HOH A:234 , HOH A:261	binding site for residue GOL A 108
9	AC9	SOFTWARE	GLN A:50 , ALA A:51 , VAL A:53 , SO4 A:102 , SO4 A:103 , GOL A:108 , HOH A:210 , HOH A:223 , HOH A:241 , HOH A:261	binding site for residue GOL A 109

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:83
                                                                                                                  
               SCOP domains ----------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........hhhhhhhh...hhhhhhhhhhh....hhhhhhhhhh..eeeeeee..eeee.......ee............. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------- Transcript
                  5wqr A  1 AAPANAVTADDPTAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQANVGEGDWKGCQLFPGKLINVNGWCASWTLKAG 83
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GOL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SF4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5wqr)

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	5wqr
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HIP_THETI \| P80176
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HIP_THETI \| P80176
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description