|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 3PF5) |
(no "Cis Peptide Bond" information available for 3PF5) |
Asymmetric Unit (3, 6)
|
Asymmetric Unit (1, 2)
|
(no "Exon" information available for 3PF5) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:66 aligned with CSPB_BACSU | P32081 from UniProtKB/Swiss-Prot Length:67 Alignment length:66 10 20 30 40 50 60 CSPB_BACSU 1 MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE 66 SCOP domains d3pf5a_ A: Major cold shock protein SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ----------------L--------------------------S-S-------------------- SAPs(SNPs) PROSITE --------------COLD_SHOCK --------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 3pf5 A 1 MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKE 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:67 aligned with CSPB_BACSU | P32081 from UniProtKB/Swiss-Prot Length:67 Alignment length:67 10 20 30 40 50 60 CSPB_BACSU 1 MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA 67 SCOP domains d3pf5b_ B: Major cold shock protein SCOP domains CATH domains ------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------L--------------------------S-S--------------------- SAPs(SNPs) PROSITE --------------COLD_SHOCK ---------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 3pf5 B 1 MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA 67 10 20 30 40 50 60 Chain R from PDB Type:RNA Length:5 3pf5 R 1 UUUUU 5 Chain S from PDB Type:RNA Length:1 3pf5 S 1 U 1
|
Asymmetric Unit |
(no "CATH Domain" information available for 3PF5) |
(no "Pfam Domain" information available for 3PF5) |
Asymmetric Unit(hide GO term definitions) Chain A,B (CSPB_BACSU | P32081)
|
|
|
|
|
|
|