|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (3, 3)
|
(no "SS Bond" information available for 2HAX) |
(no "Cis Peptide Bond" information available for 2HAX) |
(no "SAP(SNP)/Variant" information available for 2HAX) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 2HAX) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:66 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 SCOP domains d2haxa_ A: Major cold shock protein SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------COLD_SHOCK --------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 2hax A 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:66 aligned with CSPB_BACCL | P41016 from UniProtKB/Swiss-Prot Length:66 Alignment length:66 10 20 30 40 50 60 CSPB_BACCL 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 SCOP domains d2haxb_ B: Major cold shock protein SCOP domains CATH domains ------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------ SAPs(SNPs) PROSITE --------------COLD_SHOCK --------------------------------- PROSITE Transcript ------------------------------------------------------------------ Transcript 2hax B 1 MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFEIVQGNRGPQAANVVKL 66 10 20 30 40 50 60 Chain C from PDB Type:DNA Length:6 2hax C 1 TTTTTT 6 Chain D from PDB Type:DNA Length:6 2hax D 1 TTTTTT 6
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 2HAX) |
(no "Pfam Domain" information available for 2HAX) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (CSPB_BACCL | P41016)
|
|
|
|
|
|
|