3P5H - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   STRUCTURE OF THE CARBOHYDRATE-RECOGNITION DOMAIN OF HUMAN LANGERIN WITH LAMINARITRIOSE

Authors :   H. Feinberg, M. E. Taylor, N. Razi, R. Mcbride, Y. A. Knirel, S. A. Graham K. Drickamer, W. I. Weis

Date :   08 Oct 10 (Deposition) - 08 Dec 10 (Release) - 26 Jan 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.61

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   C-Type Lectin, Carbohydrate-Binding, Sugar Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Feinberg, M. E. Taylor, N. Razi, R. Mcbride, Y. A. Knirel, S. A. Graham, K. Drickamer, W. I. Weis
Structural Basis For Langerin Recognition Of Diverse Pathogen And Mammalian Glycans Through A Single Binding Site.
J. Mol. Biol. V. 405 1027 2011
PubMed-ID: 21112338 | Reference-DOI: 10.1016/J.JMB.2010.11.039

Molecule 1 - C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PINIIIOMPA2
	Expression System Strain	:	JA221
	Expression System Taxid	:	83333
	Expression System Vector Type	:	PLASMID
	Fragment	:	LANGERIN CRD (UNP RESIDUES 193-328)
	Gene	:	CD207, CLEC4K
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	LANGERIN

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 10)

No.	Name	Count	Type	Full Name
1	BGC	6	Ligand/Ion	BETA-D-GLUCOSE
2	CA	4	Ligand/Ion	CALCIUM ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	BGC	1	Ligand/Ion	BETA-D-GLUCOSE
2	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	BGC	2	Ligand/Ion	BETA-D-GLUCOSE
2	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	BGC	1	Ligand/Ion	BETA-D-GLUCOSE
2	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 4 (1, 2)

No.	Name	Count	Type	Full Name
1	BGC	2	Ligand/Ion	BETA-D-GLUCOSE
2	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (10, 10)

No.	Name	Evidence	Residues	Description
01	AC1	SOFTWARE	GLU A:285 , ASN A:287 , GLU A:293 , ASN A:307 , ASP A:308 , CA A:500 , HOH A:676	BINDING SITE FOR RESIDUE BGC A 400
02	AC2	SOFTWARE	GLU A:285 , ASN A:287 , GLU A:293 , ASN A:307 , ASP A:308 , BGC A:400	BINDING SITE FOR RESIDUE CA A 500
03	AC3	SOFTWARE	GLU B:285 , ASN B:287 , GLU B:293 , ASN B:307 , ASP B:308 , HOH B:337 , BGC B:401 , CA B:500 , HOH B:607	BINDING SITE FOR RESIDUE BGC B 400
04	AC4	SOFTWARE	LYS A:200 , PHE A:241 , THR A:245 , HOH A:344 , HOH B:161 , GLU B:285 , ASN B:287 , BGC B:400 , HOH B:443	BINDING SITE FOR RESIDUE BGC B 401
05	AC5	SOFTWARE	GLU B:285 , ASN B:287 , GLU B:293 , ASN B:307 , ASP B:308 , BGC B:400	BINDING SITE FOR RESIDUE CA B 500
06	AC6	SOFTWARE	HOH C:172 , GLU C:285 , ASN C:287 , GLU C:293 , ASN C:307 , ASP C:308 , HOH C:356 , CA C:500	BINDING SITE FOR RESIDUE BGC C 402
07	AC7	SOFTWARE	GLU C:285 , ASN C:287 , GLU C:293 , ASN C:307 , ASP C:308 , BGC C:402	BINDING SITE FOR RESIDUE CA C 500
08	AC8	SOFTWARE	GLU D:285 , ASN D:287 , GLU D:293 , LYS D:299 , ASN D:307 , ASP D:308 , HOH D:331 , BGC D:401 , CA D:500	BINDING SITE FOR RESIDUE BGC D 400
09	AC9	SOFTWARE	LYS B:200 , PHE B:241 , THR B:245 , HOH B:335 , HOH B:363 , GLU D:285 , ASN D:287 , BGC D:400 , HOH D:716 , HOH D:717	BINDING SITE FOR RESIDUE BGC D 401
10	BC1	SOFTWARE	GLU D:285 , ASN D:287 , GLU D:293 , ASN D:307 , ASP D:308 , BGC D:400	BINDING SITE FOR RESIDUE CA D 500

Asymmetric Unit

No.	Residues
1	A:223	-	A:319
2	A:295	-	A:311
3	B:223	-	B:319
4	B:295	-	B:311
5	C:223	-	C:319
6	C:295	-	C:311
7	D:223	-	D:319
8	D:295	-	D:311

Asymmetric Unit

No.	Residues
1	Glu A:285	-	Pro A:286
2	Glu B:285	-	Pro B:286
3	Glu C:285	-	Pro C:286
4	Glu D:285	-	Pro D:286

Asymmetric Unit (5, 20)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	A/B/C/D	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	A/B/C/D	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	A/B/C/D	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	A/B/C/D	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	A/B/C/D	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	A	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	A	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	A	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	A	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	A	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	B	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	B	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	B	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	B	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	B	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	C	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	C	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	C	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	C	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	C	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (5, 5)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	D	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	D	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	D	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	D	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	D	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	4	A:202-320 B:202-320 C:202-320 D:202-320
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	4	A:295-319 B:295-319 C:295-319 D:295-319

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	1	A:202-320 - - -
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	1	A:295-319 - - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	1	- B:202-320 - -
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	1	- B:295-319 - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	1	- - C:202-320 -
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	1	- - C:295-319 -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	1	- - - D:202-320
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	1	- - - D:295-319

(no "Exon" information available for 3P5H)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:128
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:128
                                   207       217       227       237       247       257       267       277       287       297       307       317        
          CLC4K_HUMAN   198 GWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
               SCOP domains d3p5ha_ A: automated matches                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------S--------------------------------------------------R-------------A---------D-----------P------------------------- SAPs(SNPs)
                PROSITE (1) ----C_TYPE_LECTIN_2  PDB: A:202-320 UniProt: 202-320                                                                       ----- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------ PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p5h A 198 GWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
                                   207       217       227       237       247       257       267       277       287       297       307       317

Chain B from PDB  Type:PROTEIN  Length:129
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:129
                                   206       216       226       236       246       256       266       276       286       296       306       316         
          CLC4K_HUMAN   197 QGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
               SCOP domains d3p5hb_ B: automated matches                                                                                                      SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------S--------------------------------------------------R-------------A---------D-----------P------------------------- SAPs(SNPs)
                PROSITE (1) -----C_TYPE_LECTIN_2  PDB: B:202-320 UniProt: 202-320                                                                       ----- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p5h B 197 QGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
                                   206       216       226       236       246       256       266       276       286       296       306       316

Chain C from PDB  Type:PROTEIN  Length:130
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:130
                                   205       215       225       235       245       255       265       275       285       295       305       315       325
          CLC4K_HUMAN   196 SQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
               SCOP domains d3p5hc_ C: automated matches                                                                                                       SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee... Sec.struct. author
                 SAPs(SNPs) -----------------S--------------------------------------------------R-------------A---------D-----------P------------------------- SAPs(SNPs)
                PROSITE (1) ------C_TYPE_LECTIN_2  PDB: C:202-320 UniProt: 202-320                                                                       ----- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------ PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p5h C 196 SQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
                                   205       215       225       235       245       255       265       275       285       295       305       315       325

Chain D from PDB  Type:PROTEIN  Length:128
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:128
                                   206       216       226       236       246       256       266       276       286       296       306       316        
          CLC4K_HUMAN   197 QGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYV 324
               SCOP domains d3p5hd_ D: automated matches                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------Lectin_C-3p5hD01 D:212-321                                                                                    --- Pfam domains (1)
           Pfam domains (2) ---------------Lectin_C-3p5hD02 D:212-321                                                                                    --- Pfam domains (2)
           Pfam domains (3) ---------------Lectin_C-3p5hD03 D:212-321                                                                                    --- Pfam domains (3)
           Pfam domains (4) ---------------Lectin_C-3p5hD04 D:212-321                                                                                    --- Pfam domains (4)
         Sec.struct. author ...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------S--------------------------------------------------R-------------A---------D-----------P------------------------ SAPs(SNPs)
                PROSITE (1) -----C_TYPE_LECTIN_2  PDB: D:202-320 UniProt: 202-320                                                                       ---- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ----- PROSITE (2)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3p5h D 197 QGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYV 324
                                   206       216       226       236       246       256       266       276       286       296       306       316

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: C-type lectin-like (322)

Superfamily: C-type lectin-like (322)

Family: automated matches (88)

Protein domain: automated matches (88)

Human (Homo sapiens) [TaxId: 9606] (60)

1a	d3p5ha_	A:
1b	d3p5hb_	B:
1c	d3p5hc_	C:
1d	d3p5hd_	D:

(no "CATH Domain" information available for 3P5H)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: C_Lectin (98)

Family: Lectin_C (85)

Homo sapiens (Human) (39)

1a	Lectin_C-3p5hD01	D:212-321
1b	Lectin_C-3p5hD02	D:212-321
1c	Lectin_C-3p5hD03	D:212-321
1d	Lectin_C-3p5hD04	D:212-321

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (CLC4K_HUMAN | Q9UJ71)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0005537	mannose binding	Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
biological process
	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0006898	receptor-mediated endocytosis	An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
cellular component
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		BGC	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]
		AC9	[ RasMol ]	+environment [ RasMol ]
		BC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:285 - Pro A:286	[ RasMol ]
		Glu B:285 - Pro B:286	[ RasMol ]
		Glu C:285 - Pro C:286	[ RasMol ]
		Glu D:285 - Pro D:286	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3p5h
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CLC4K_HUMAN \| Q9UJ71
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613393
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CLC4K_HUMAN \| Q9UJ71
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 10)

Sites (10, 10)

SS Bonds (8, 8)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 20)

PROSITE Motifs (2, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File