3KQG - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   TRIMERIC STRUCTURE OF LANGERIN

Authors :   H. Feinberg, A. S. Powlesland, M. E. Taylor, W. I. Weis

Date :   17 Nov 09 (Deposition) - 23 Feb 10 (Release) - 05 May 10 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Trimer, Neck And Crd, Coiled Coil, Lectin, Immune System (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   H. Feinberg, A. S. Powlesland, M. E. Taylor, W. I. Weis
Trimeric Structure Of Langerin.
J. Biol. Chem. V. 285 13285 2010
PubMed-ID: 20181944 | Reference-DOI: 10.1074/JBC.M109.086058

Molecule 1 - C-TYPE LECTIN DOMAIN FAMILY 4 MEMBER K
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PT5T EXPRESSION VECTOR
	Expression System Strain	:	BL21/DE3
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 147-328
	Gene	:	CD207, CLEC4K
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	LANGERIN

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	CA	6	Ligand/Ion	CALCIUM ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	CA	-1	Ligand/Ion	CALCIUM ION

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	HOH A:1 , HOH A:2 , GLU A:285 , ASN A:287 , GLU A:293 , ASN A:307 , ASP A:308	BINDING SITE FOR RESIDUE CA A 400
2	AC2	SOFTWARE	HOH B:3 , HOH B:4 , GLU B:285 , ASN B:287 , GLU B:293 , ASN B:307 , ASP B:308	BINDING SITE FOR RESIDUE CA B 400
3	AC3	SOFTWARE	HOH C:5 , HOH C:6 , GLU C:285 , ASN C:287 , GLU C:293 , ASN C:307 , ASP C:308	BINDING SITE FOR RESIDUE CA C 400
4	AC4	SOFTWARE	HOH D:7 , HOH D:8 , GLU D:285 , ASN D:287 , GLU D:293 , ASN D:307 , ASP D:308	BINDING SITE FOR RESIDUE CA D 400
5	AC5	SOFTWARE	HOH E:9 , HOH E:10 , GLU E:285 , ASN E:287 , GLU E:293 , ASN E:307 , ASP E:308	BINDING SITE FOR RESIDUE CA E 400
6	AC6	SOFTWARE	HOH F:11 , HOH F:12 , GLU F:285 , ASN F:287 , GLU F:293 , ASN F:307 , ASP F:308	BINDING SITE FOR RESIDUE CA F 400

Asymmetric Unit

No.	Residues
1	A:223	-	A:319
2	A:295	-	A:311
3	B:223	-	B:319
4	B:295	-	B:311
5	C:223	-	C:319
6	C:295	-	C:311
7	D:223	-	D:319
8	D:295	-	D:311
9	E:223	-	E:319
10	E:295	-	E:311
11	F:223	-	F:319
12	F:295	-	F:311

Asymmetric Unit

No.	Residues
1	Glu A:285	-	Pro A:286
2	Glu B:285	-	Pro B:286
3	Glu C:285	-	Pro C:286
4	Glu D:285	-	Pro D:286
5	Glu E:285	-	Pro E:286
6	Glu F:285	-	Pro F:286

Asymmetric Unit (5, 30)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	A/B/C/D/E/F	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	A/B/C/D/E/F	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	A/B/C/D/E/F	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	A/B/C/D/E/F	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	A/B/C/D/E/F	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (5, 15)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	A/B/C	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	A/B/C	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	A/B/C	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	A/B/C	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	A/B/C	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (5, 15)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_054782	P	213	S	CLC4K_HUMAN	Polymorphism	17006436	D/E/F	P	213	S
2	UniProt	VAR_063828	W	264	R	CLC4K_HUMAN	Disease (BIRGD)	200837270	D/E/F	W	264	R
3	UniProt	VAR_054783	V	278	A	CLC4K_HUMAN	Polymorphism	741326	D/E/F	A	278	A
4	UniProt	VAR_054784	N	288	D	CLC4K_HUMAN	Polymorphism	13383830	D/E/F	N	288	D
5	UniProt	VAR_059448	A	300	P	CLC4K_HUMAN	Polymorphism	2080391	D/E/F	A	300	P

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 12)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	6	A:202-320 B:202-320 C:202-320 D:202-320 E:202-320 F:202-320
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	6	A:295-319 B:295-319 C:295-319 D:295-319 E:295-319 F:295-319

Biological Unit 1 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	3	A:202-320 B:202-320 C:202-320 - - -
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	3	A:295-319 B:295-319 C:295-319 - - -

Biological Unit 2 (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	C_TYPE_LECTIN_2	PS50041	C-type lectin domain profile.	CLC4K_HUMAN	202-320	3	- - - D:202-320 E:202-320 F:202-320
2	C_TYPE_LECTIN_1	PS00615	C-type lectin domain signature.	CLC4K_HUMAN	295-319	3	- - - D:295-319 E:295-319 F:295-319

(no "Exon" information available for 3KQG)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:169
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:169
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318         
          CLC4K_HUMAN   159 SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE 327
               SCOP domains d3kqga2 A:159-198 Surfactant protein    d3kqga1 A:199-327 automated matches                                                                                               SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeee......eee......hhhhhh................eeee.......eeee......eeeeeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------S--------------------------------------------------R-------------A---------D-----------P--------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------------C_TYPE_LECTIN_2  PDB: A:202-320 UniProt: 202-320                                                                       ------- PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          -------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kqg A 159 SDLEKASALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPSE 327
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318

Chain B from PDB  Type:PROTEIN  Length:157
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:159
                                   176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
          CLC4K_HUMAN   167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
               SCOP domains d3kqgb2 B:167-198               d3kqgb1 B:199-325 automated matches                                                                                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeeee.--.eeee......hhhhhh.........hhhhh..eeee.......eeee......eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------S--------------------------------------------------R-------------A---------D-----------P------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------C_TYPE_LECTIN_2  PDB: B:202-320 UniProt: 202-320                                                                       ----- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kqg B 167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAG--GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
                                   176       186       196       206       216       226       236       246       256  |  | 266       276       286       296       306       316         
                                                                                                                      259  |                                                               
                                                                                                                         262

Chain C from PDB  Type:PROTEIN  Length:159
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:159
                                   176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
          CLC4K_HUMAN   167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
               SCOP domains d3kqgc2 C:167-198               d3kqgc1 C:199-325 automated matches                                                                                             SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------S--------------------------------------------------R-------------A---------D-----------P------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------C_TYPE_LECTIN_2  PDB: C:202-320 UniProt: 202-320                                                                       ----- PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------ PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kqg C 167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVP 325
                                   176       186       196       206       216       226       236       246       256       266       276       286       296       306       316

Chain D from PDB  Type:PROTEIN  Length:158
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:161
                                   175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325 
          CLC4K_HUMAN   166 ALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
               SCOP domains d3kqgd2 D:166-198                d3kqgd1 D:199-326 automated matches                                                                                              SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhhh..ee....hhhhhhhhhhhhh...eeeeeee.---..eee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee.... Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------S--------------------------------------------------R-------------A---------D-----------P-------------------------- SAPs(SNPs)
                PROSITE (1) ------------------------------------C_TYPE_LECTIN_2  PDB: D:202-320 UniProt: 202-320                                                                       ------ PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kqg D 166 ALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKA---GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
                                   175       185       195       205       215       225       235       245       255  |   |265       275       285       295       305       315       325 
                                                                                                                      258 262

Chain E from PDB  Type:PROTEIN  Length:160
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:160
                                   176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326
          CLC4K_HUMAN   167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
               SCOP domains d3kqge2 E:167-198               d3kqge1 E:199-326 automated matches                                                                                              SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeee......eee........hhhhhhh......hhhhh..eeee.......eeee......eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------S--------------------------------------------------R-------------A---------D-----------P-------------------------- SAPs(SNPs)
                PROSITE (1) -----------------------------------C_TYPE_LECTIN_2  PDB: E:202-320 UniProt: 202-320                                                                       ------ PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3kqg E 167 LNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
                                   176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326

Chain F from PDB  Type:PROTEIN  Length:162
 aligned with CLC4K_HUMAN | Q9UJ71 from UniProtKB/Swiss-Prot  Length:328

    Alignment length:162
                                   174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324  
          CLC4K_HUMAN   165 SALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
               SCOP domains d3kqgf2 F:165-198                 d3kqgf1 F:199-326 automated matches                                                                                              SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -----------------------------------------------Lectin_C-3kqgF01 F:212-321                                                                                    ----- Pfam domains (1)
           Pfam domains (2) -----------------------------------------------Lectin_C-3kqgF02 F:212-321                                                                                    ----- Pfam domains (2)
           Pfam domains (3) -----------------------------------------------Lectin_C-3kqgF03 F:212-321                                                                                    ----- Pfam domains (3)
           Pfam domains (4) -----------------------------------------------Lectin_C-3kqgF04 F:212-321                                                                                    ----- Pfam domains (4)
           Pfam domains (5) -----------------------------------------------Lectin_C-3kqgF05 F:212-321                                                                                    ----- Pfam domains (5)
           Pfam domains (6) -----------------------------------------------Lectin_C-3kqgF06 F:212-321                                                                                    ----- Pfam domains (6)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eee..eeeee.....hhhhhhhhhhh...ee....hhhhhhhhhhhhh...eeeeeeee....eeee......hhhhhhhhh......hhhhh..eeee.......eeee......eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------S--------------------------------------------------R-------------A---------D-----------P-------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------------------C_TYPE_LECTIN_2  PDB: F:202-320 UniProt: 202-320                                                                       ------ PROSITE (1)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------------------------C_TYPE_LECTIN_1          ------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3kqg F 165 SALNTKIRALQGSLENMSKLLKRQNDILQVVSQGWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEFLYKTAGGLIYWIGLTKAGMEGDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICKRPYVPS 326
                                   174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: C-type lectin-like (322)

Superfamily: C-type lectin-like (322)

Family: automated matches (88)

Protein domain: automated matches (88)

Human (Homo sapiens) [TaxId: 9606] (60)

1a	d3kqga1	A:199-327
1b	d3kqgb1	B:199-325
1c	d3kqgc1	C:199-325
1d	d3kqgd1	D:199-326
1e	d3kqge1	E:199-326
1f	d3kqgf1	F:199-326

Class: Coiled coil proteins (689)

Fold: Parallel coiled-coil (407)

Superfamily: Triple coiled coil domain of C-type lectins (54)

Family: Triple coiled coil domain of C-type lectins (54)

Protein domain: Surfactant protein (30)

Human (Homo sapiens), SP-D [TaxId: 9606] (24)

2a	d3kqga2	A:159-198
2b	d3kqgb2	B:167-198
2c	d3kqgc2	C:167-198
2d	d3kqgd2	D:166-198
2e	d3kqge2	E:167-198
2f	d3kqgf2	F:165-198

(no "CATH Domain" information available for 3KQG)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: C_Lectin (98)

Family: Lectin_C (85)

Homo sapiens (Human) (39)

1a	Lectin_C-3kqgF01	F:212-321
1b	Lectin_C-3kqgF02	F:212-321
1c	Lectin_C-3kqgF03	F:212-321
1d	Lectin_C-3kqgF04	F:212-321
1e	Lectin_C-3kqgF05	F:212-321
1f	Lectin_C-3kqgF06	F:212-321

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (CLC4K_HUMAN | Q9UJ71)

molecular function
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0005537	mannose binding	Interacting selectively and non-covalently with mannose, a monosaccharide hexose, stereoisomeric with glucose, that occurs naturally only in polymerized forms called mannans.
biological process
	GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	The process in which an antigen-presenting cell expresses a peptide antigen of exogenous origin on its cell surface in association with an MHC class I protein complex following intracellular transport via a TAP (transporter associated with antigen processing) pathway. The peptide is typically a fragment of a larger exogenous protein which has been degraded within the cell and is dependent on TAP transport from the cytosol to ER for association with the MHC class I molecule. Class I here refers to classical class I molecules.
	GO:0051607	defense response to virus	Reactions triggered in response to the presence of a virus that act to protect the cell or organism.
	GO:0006898	receptor-mediated endocytosis	An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
cellular component
	GO:0030669	clathrin-coated endocytic vesicle membrane	The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
	GO:0031901	early endosome membrane	The lipid bilayer surrounding an early endosome.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Glu A:285 - Pro A:286	[ RasMol ]
		Glu B:285 - Pro B:286	[ RasMol ]
		Glu C:285 - Pro C:286	[ RasMol ]
		Glu D:285 - Pro D:286	[ RasMol ]
		Glu E:285 - Pro E:286	[ RasMol ]
		Glu F:285 - Pro F:286	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	3kqg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CLC4K_HUMAN \| Q9UJ71
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	613393
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CLC4K_HUMAN \| Q9UJ71
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 3KQG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (12, 12)

Cis Peptide Bonds (6, 6)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (5, 30)

PROSITE Motifs (2, 12)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 12)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (11, 11)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File