|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 3OV5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 3OV5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 3OV5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 3OV5) |
Exons (0, 0)| (no "Exon" information available for 3OV5) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:84 aligned with Q8PJB3_XANAC | Q8PJB3 from UniProtKB/TrEMBL Length:139 Alignment length:84 60 70 80 90 100 110 120 130 Q8PJB3_XANAC 51 TSYTYQATPMDGTLKTMLERWAADSNMQLSYNLPSDYTLIGPVSAISTTSVQQAATELSAVYAAQGVSVSVSANKLLVQPVPVS 134 SCOP domains ------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------ Transcript 3ov5 A 51 TSYTYQATPMDGTLKTMLERWAADSNMQLSYNLPSDYTLIGPVSAISTTSVQQAATELSAVYAAQGVSVSVSANKLLVQPVPVS 134 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 3OV5) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 3OV5) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 3OV5) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 3OV5)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|