3OUE - JenaLib

Title :   STRUCTURE OF C-TERMINAL HEXAHEME FRAGMENT OF GSU1996

Authors :   P. R. Pokkuluri, M. Schiffer

Date :   14 Sep 10 (Deposition) - 29 Dec 10 (Release) - 30 Mar 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.15

Chains :   Asym./Biol. Unit : A

Keywords :   Multiheme Cytochrome-C, Electron Transfer, Fe Reduction, Geobacter Sulfurreducens, Cytochrome C7 (C3) Fold, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. R. Pokkuluri, Y. Y. Londer, N. E. Duke, M. Pessanha, X. Yang, V. Orshonsky, L. Orshonsky, J. Erickson, Y. Zagyanskiy, C. A. Salgueiro, M. Schiffer
Structure Of A Novel Dodecaheme Cytochrome C From Geobacter Sulfurreducens Reveals An Extended 12Nm Protein With Interacting Hemes.
J. Struct. Biol. V. 174 223 2011
PubMed-ID: 21130881 | Reference-DOI: 10.1016/J.JSB.2010.11.022
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 8)

Sites (8, 8)

Asymmetric Unit (8, 8)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	LYS A:189 , CYS A:190 , ASN A:191 , PHE A:306 , SER A:307 , ASP A:310 , HOH A:431 , HOH A:445 , HOH A:460	BINDING SITE FOR RESIDUE SO4 A 500
2	AC2	SOFTWARE	LYS A:236 , THR A:286 , ALA A:288 , ASP A:289	BINDING SITE FOR RESIDUE SO4 A 501
3	AC3	SOFTWARE	PRO A:164 , PHE A:169 , PHE A:179 , HIS A:181 , LEU A:185 , TYR A:188 , LYS A:189 , CYS A:190 , CYS A:193 , HIS A:194 , PHE A:198 , TYR A:200 , LYS A:201 , ALA A:202 , GLY A:302 , ASP A:304 , HOH A:432 , HEM A:608 , HEM A:611	BINDING SITE FOR RESIDUE HEM A 607
4	AC4	SOFTWARE	ALA A:178 , PHE A:179 , PHE A:183 , HIS A:184 , MET A:187 , TYR A:188 , CYS A:193 , CYS A:218 , CYS A:221 , HIS A:222 , ALA A:227 , PHE A:228 , LYS A:236 , CYS A:237 , SER A:251 , MET A:287 , ALA A:288 , HEM A:607 , HEM A:609 , HEM A:612	BINDING SITE FOR RESIDUE HEM A 608
5	AC5	SOFTWARE	PHE A:169 , MET A:171 , VAL A:174 , ALA A:177 , ARG A:206 , PHE A:207 , THR A:208 , MET A:209 , MET A:212 , PHE A:228 , SER A:230 , ALA A:231 , SER A:232 , CYS A:234 , CYS A:237 , HIS A:238 , TYR A:278 , HEM A:608	BINDING SITE FOR RESIDUE HEM A 609
6	AC6	SOFTWARE	LEU A:241 , LYS A:242 , ALA A:244 , LEU A:246 , TYR A:248 , PHE A:257 , HIS A:259 , HIS A:262 , LEU A:263 , PHE A:266 , LYS A:267 , CYS A:268 , CYS A:271 , HIS A:272 , PHE A:276 , TYR A:278 , ARG A:279 , LYS A:280 , GLY A:281 , SER A:282 , HOH A:452 , HEM A:611	BINDING SITE FOR RESIDUE HEM A 610
7	AC7	SOFTWARE	MET A:161 , TYR A:200 , TYR A:256 , PHE A:257 , HIS A:262 , MET A:265 , PHE A:266 , CYS A:296 , CYS A:299 , HIS A:300 , ALA A:305 , PHE A:306 , LYS A:314 , HOH A:401 , HOH A:402 , HEM A:607 , HEM A:610 , HEM A:612	BINDING SITE FOR RESIDUE HEM A 611
8	AC8	SOFTWARE	PHE A:183 , TYR A:248 , THR A:250 , SER A:251 , VAL A:252 , PRO A:284 , ALA A:285 , THR A:286 , MET A:287 , MET A:290 , VAL A:308 , ALA A:309 , CYS A:312 , CYS A:315 , HIS A:316 , HOH A:436 , HOH A:441 , HEM A:608 , HEM A:611	BINDING SITE FOR RESIDUE HEM A 612

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:158
 aligned with Q74BP5_GEOSL | Q74BP5 from UniProtKB/TrEMBL  Length:343

    Alignment length:158
                                   195       205       215       225       235       245       255       265       275       285       295       305       315       325       335        
         Q74BP5_GEOSL   186 MTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCHPGLKPAKLTYKTSVGEAYFDHDIHLSMFKCADCHTKVFKYRKGSAPATMADMEKGKSCGVCHNGKDAFSVADDCVKCHNM 343
               SCOP domains d3ouea1 A:161-239 automated matches                                            d3ouea2 A:240-318 automated matches                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eee.......eeehhhhhhh..hhhhh..............hhhhhhh.hhhhhh...........hhhhhhhhhh...eeeee..eeeeehhhhhhh..hhhhh..............hhhhhhh.hhhhhh...........hhhh.ee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 3oue A 161 MTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCHPGLKPAKLTYKTSVGEAYFDHDIHLSMFKCADCHTKVFKYRKGSAPATMADMEKGKSCGVCHNGKDAFSVADDCVKCHNM 318
                                   170       180       190       200       210       220       230       240       250       260       270       280       290       300       310

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (2, 2)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (1, 1)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]
		AC7	[ RasMol ]	+environment [ RasMol ]
		AC8	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		His A:194 - Thr A:195	[ RasMol ]
		His A:272 - Thr A:273	[ RasMol ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	3oue
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q74BP5_GEOSL \| Q74BP5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q74BP5_GEOSL \| Q74BP5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description