1RWJ - JenaLib

Title :   C7-TYPE THREE-HEME CYTOCHROME DOMAIN

Authors :   P. R. Pokkuluri, Y. Y. Londer, N. E. C. Duke, J. Erickson, M. Pessanha, C. A. Salgueiro, M. Schiffer

Date :   16 Dec 03 (Deposition) - 03 Aug 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.70

Chains :   Asym./Biol. Unit : A

Keywords :   Multiheme Cytochrome C, Cytochrome C7, Geobacter Sulfurreducens, Geobacter Metallireducens, Heme Coordination In C-Type Cytochromes, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   P. R. Pokkuluri, Y. Y. Londer, N. E. C. Duke, J. Erickson, M. Pessanha, C. A. Salgueiro, M. Schiffer
Structure Of A Novel C7-Type Three-Heme Cytochrome Domain From A Multidomain Cytochrome C Polymer.
Protein Sci. V. 13 1684 2004
PubMed-ID: 15133162 | Reference-DOI: 10.1110/PS.04626204
(for further references see the PDB file header)

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 3)

Sites (3, 3)

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:2 , MET A:3 , PRO A:5 , PRO A:6 , PHE A:11 , GLY A:15 , PHE A:21 , HIS A:23 , HIS A:26 , LEU A:27 , TYR A:30 , LYS A:31 , CYS A:32 , CYS A:35 , HIS A:36 , PHE A:40 , TYR A:42 , LYS A:43 , ALA A:44 , GLY A:45 , HEM A:91 , HOH A:105 , HOH A:106 , HOH A:109 , HOH A:113 , HOH A:158 , HOH A:161 , HOH A:200	BINDING SITE FOR RESIDUE HEM A 90
2	AC2	SOFTWARE	ALA A:20 , PHE A:21 , PHE A:25 , HIS A:26 , TYR A:30 , THR A:37 , CYS A:60 , CYS A:63 , HIS A:64 , ASP A:68 , ALA A:69 , PHE A:70 , LYS A:78 , CYS A:79 , HEM A:90 , HEM A:92 , HOH A:108 , HOH A:184	BINDING SITE FOR RESIDUE HEM A 91
3	AC3	SOFTWARE	LYS A:1 , MET A:3 , THR A:4 , MET A:13 , ALA A:19 , TYR A:42 , ARG A:48 , PHE A:49 , THR A:50 , MET A:51 , MET A:54 , HIS A:64 , SER A:72 , SER A:74 , ASP A:75 , CYS A:76 , CYS A:79 , HIS A:80 , HEM A:91 , HOH A:101 , HOH A:102 , HOH A:113 , HOH A:116 , HOH A:148	BINDING SITE FOR RESIDUE HEM A 92

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:81
 aligned with Q74BP5_GEOSL | Q74BP5 from UniProtKB/TrEMBL  Length:343

    Alignment length:81
                                   193       203       213       223       233       243       253       263 
         Q74BP5_GEOSL   184 KGMTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCHP 264
               SCOP domains d1rwja_ A: Cytochrome c7 (cytochrome c551.5, PpcA)                                SCOP domains
               CATH domains 1rwjA00 A:1-81 Cytochrome C3                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.......eeeehhhhh...hhhhh..............hhhhhhhhhhhhhh...........hhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------- Transcript
                 1rwj A   1 KGMTPPKTVNFKMKGVADAAFSHEFHLGMYKCNECHTKLFAYKAGAKRFTMADMDKGKSCGACHNGKDAFSSASDCGKCHP  81
                                    10        20        30        40        50        60        70        80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (0, 0)

Gene Ontology (1, 1)

Visualization

Interactive Views

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		HEM	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		His A:36 - Thr A:37	[ RasMol ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1rwj
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	Q74BP5_GEOSL \| Q74BP5
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/TrEMBL

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	Q74BP5_GEOSL \| Q74BP5
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description