Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  THE X-RAY CRYSTAL STRUCTURE OF PCSK9 IN COMPLEX WITH THE LDL RECEPTOR
 
Authors :  G. Spraggon, E. N. Hampton
Date :  02 Mar 10  (Deposition) - 16 Mar 11  (Release) - 16 Mar 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  7.01
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Protein Complex, Beta Propeller, Cholesterol Clearance, Pcsk9, Ldlr, Autocatalytic Cleavage, Cholesterol Metabolism, Disease Mutation, Disulfide Bond, Glycoprotein, Hydrolase, Lipid Metabolism, Phosphoprotein, Protease, Secreted, Serine Protease, Steroid Metabolism, Zymogen, Coated Pit, Egf-Like Domain, Endocytosis, Host- Virus Interaction, Ldl, Lipid Transport, Membrane, Receptor, Transmembrane, Transport, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. Li, J. A. Gavigan, G. Zheng, W. Huang, D. Yowe, S. Geisse, J. L. Harris S. A. Lesley, G. Spraggon
The X-Ray Crystal Structure Of Pcsk9 In Complex With The Ld Receptor
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    ChainsA
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System CommonHUMAN
    Expression System Taxid9606
    FragmentPCSK9
    GeneNARC1, PCSK9, PSEC0052
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1
 
Molecule 2 - PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    ChainsB
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System CommonHUMAN
    Expression System Taxid9606
    FragmentPCSK9
    GeneNARC1, PCSK9, PSEC0052
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9, NEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1
 
Molecule 3 - LOW-DENSITY LIPOPROTEIN RECEPTOR
    ChainsC
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System CommonHUMAN
    Expression System Taxid9606
    FragmentLDLR
    GeneLDLR
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymLDL RECEPTOR

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric/Biological Unit (1, 3)
No.NameCountTypeFull Name
1CA3Ligand/IonCALCIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETHR C:294 , GLU C:296 , ASP C:310 , LEU C:311 , GLY C:314BINDING SITE FOR RESIDUE CA C 1001
2AC2SOFTWAREASP C:333 , ASP C:335 , LEU C:350 , GLU C:351BINDING SITE FOR RESIDUE CA C 1002
3AC3SOFTWARELYS C:273 , ASN C:276 , ASP C:280 , ASP C:286 , GLU C:287BINDING SITE FOR RESIDUE CA C 1003

(-) SS Bonds  (23, 23)

Asymmetric/Biological Unit
No.Residues
1B:223 -B:255
2B:323 -B:358
3B:375 -B:378
4B:457 -B:527
5B:477 -B:526
6B:486 -B:509
7B:534 -B:601
8B:552 -B:600
9B:562 -B:588
10B:608 -B:679
11B:626 -B:678
12B:635 -B:654
13C:255 -C:268
14C:263 -C:281
15C:297 -C:308
16C:304 -C:317
17C:319 -C:331
18C:337 -C:347
19C:343 -C:356
20C:358 -C:371
21C:646 -C:660
22C:656 -C:675
23C:677 -C:690

(-) Cis Peptide Bonds  (3, 3)

Asymmetric/Biological Unit
No.Residues
1Ser B:326 -Pro B:327
2Asp C:339 -Pro C:340
3Val C:643 -Asn C:644

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (137, 137)

Asymmetric/Biological Unit (137, 137)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
001UniProtVAR_058520T77IPCSK9_HUMANPolymorphism756060557AT77I
002UniProtVAR_058521R93CPCSK9_HUMANPolymorphism151193009AR93C
003UniProtVAR_058522G106RPCSK9_HUMANPolymorphism  ---AG106R
004UniProtVAR_058523V114APCSK9_HUMANPolymorphism775988212AV114A
005UniProtVAR_017199S127RPCSK9_HUMANDisease (HCHOLA3)28942111AS127R
006UniProtVAR_058524D129GPCSK9_HUMANDisease (HCHOLA3)  ---AD129G
007UniProtVAR_058525N157KPCSK9_HUMANPolymorphism143117125BN157K
008UniProtVAR_025452R237WPCSK9_HUMANPolymorphism148195424BR237W
009UniProtVAR_058529A239DPCSK9_HUMANPolymorphism  ---BA239D
010UniProtVAR_025453L253FPCSK9_HUMANPolymorphism28362270BL253F
011UniProtVAR_062375C276RLDLR_HUMANDisease (FH)879254692CC255R
012UniProtVAR_072837C276WLDLR_HUMANUnclassified (FH)  ---CC255W
013UniProtVAR_005349C276YLDLR_HUMANDisease (FH)730882089CC255Y
014UniProtVAR_005350E277KLDLR_HUMANUnclassified (FH)148698650CE256K
015UniProtVAR_072838H285YLDLR_HUMANUnclassified (FH)730882091CH264Y
016UniProtVAR_005351S286RLDLR_HUMANUnclassified (FH)140241383CS265R
017UniProtVAR_007983E288KLDLR_HUMANDisease (FH)368657165CE267K
018UniProtVAR_072839R300GLDLR_HUMANDisease (FH)767618089CR279G
019UniProtVAR_005352D301ALDLR_HUMANDisease (FH)879254714CD280A
020UniProtVAR_072840D301GLDLR_HUMANDisease (FH)879254714CD280G
021UniProtVAR_005354C302WLDLR_HUMANDisease (FH)879254716CC281W
022UniProtVAR_005353C302YLDLR_HUMANDisease (FH)879254715CC281Y
023UniProtVAR_005356D304ELDLR_HUMANPolymorphism875989909CD283E
024UniProtVAR_005355D304NLDLR_HUMANPolymorphism121908030CD283N
025UniProtVAR_005357S306LLDLR_HUMANUnclassified (FH)11547917CS285L
026UniProtVAR_005358C313YLDLR_HUMANDisease (FH)875989910CC292Y
027UniProtVAR_072841G314RLDLR_HUMANUnclassified (FH)72658858CG293R
028UniProtVAR_005360C318FLDLR_HUMANDisease (FH)879254739CC297F
029UniProtVAR_062376C318RLDLR_HUMANDisease (FH)879254738CC297R
030UniProtVAR_005359C318YLDLR_HUMANPolymorphism879254739CC297Y
031UniProtVAR_072842S326CLDLR_HUMANUnclassified (FH)879254747CS305C
032UniProtVAR_005361H327YLDLR_HUMANDisease (FH)747507019CH306Y
033UniProtVAR_067196C329FLDLR_HUMANDisease (FH)  ---CC308F
034UniProtVAR_005362C329YLDLR_HUMANDisease (FH)761954844CC308Y
035UniProtVAR_005363G335SLDLR_HUMANPolymorphism544453230CG314S
036UniProtVAR_005364C338SLDLR_HUMANDisease (FH)879254753CC317S
037UniProtVAR_005365D342ELDLR_HUMANUnclassified  ---CD321E
038UniProtVAR_005366D342NLDLR_HUMANUnclassified (FH)139361635CD321N
039UniProtVAR_005367G343SLDLR_HUMANUnclassified (FH)730882096CG322S
040UniProtVAR_005368R350PLDLR_HUMANDisease (FH)875989914CR329P
041UniProtVAR_072843C352RLDLR_HUMANUnclassified (FH)879254769CC331R
042UniProtVAR_005369C352YLDLR_HUMANPolymorphism193922566CC331Y
043UniProtVAR_005370D354GLDLR_HUMANPolymorphism755449669CD333G
044UniProtVAR_005371D354VLDLR_HUMANUnclassified  ---CD333V
045UniProtVAR_007984D356YLDLR_HUMANDisease (FH)  ---CD335Y
046UniProtVAR_005372E357KLDLR_HUMANPolymorphism879254781CE336K
047UniProtVAR_062377C358YLDLR_HUMANDisease (FH)875989915CC337Y
048UniProtVAR_005373C364RLDLR_HUMANPolymorphism879254787CC343R
049UniProtVAR_007985Q366RLDLR_HUMANDisease (FH)746982741CQ345R
050UniProtVAR_005374C368RLDLR_HUMANDisease (FH)  ---CC347R
051UniProtVAR_072844C368YLDLR_HUMANUnclassified (FH)768430352CC347Y
052UniProtVAR_062378N370TLDLR_HUMANDisease (FH)879254792CN349T
053UniProtVAR_072845G373DLDLR_HUMANUnclassified (FH)879254797CG352D
054UniProtVAR_058530R357HPCSK9_HUMANDisease (HCHOLA3)370507566BR357H
055UniProtVAR_005375C379RLDLR_HUMANPolymorphism879254803CC358R
056UniProtVAR_007986C379YLDLR_HUMANDisease (FH)879254804CC358Y
057UniProtVAR_024519A391TLDLR_HUMANPolymorphism11669576CA370T
058UniProtVAR_058531D374HPCSK9_HUMANDisease (HCHOLA3)  ---BY374H
059UniProtVAR_058532D374YPCSK9_HUMANDisease (HCHOLA3)137852912BY374Y
060UniProtVAR_005376A399DLDLR_HUMANDisease (FH)875989918CA378D
061UniProtVAR_005377L401HLDLR_HUMANPolymorphism121908038CL380H
062UniProtVAR_007987L401VLDLR_HUMANDisease (FH)146200173CL380V
063UniProtVAR_008995F403LLDLR_HUMANDisease (FH)879254831CF382L
064UniProtVAR_072846T404PLDLR_HUMANUnclassified (FH)879254834CT383P
065UniProtVAR_013954R406QLDLR_HUMANPolymorphism552422789CR385Q
066UniProtVAR_072847R406WLDLR_HUMANUnclassified (FH)121908043CR385W
067UniProtVAR_005378E408KLDLR_HUMANUnclassified (FH)137943601CE387K
068UniProtVAR_025454H391NPCSK9_HUMANPolymorphism146471967BH391N
069UniProtVAR_005379L414RLDLR_HUMANDisease (FH)748554592CL393R
070UniProtVAR_062379D415GLDLR_HUMANDisease (FH)879254845CD394G
071UniProtVAR_067282G394SPCSK9_HUMANUnclassified368257906BG394S
072UniProtVAR_005380R416QLDLR_HUMANDisease (FH)773658037CR395Q
073UniProtVAR_005381R416WLDLR_HUMANDisease (FH)570942190CR395W
074UniProtVAR_005382I423TLDLR_HUMANDisease (FH)879254849CI402T
075UniProtVAR_005383V429MLDLR_HUMANDisease (FH)28942078CV408M
076UniProtVAR_005384A431TLDLR_HUMANUnclassified (FH)28942079CA410T
077UniProtVAR_007988L432VLDLR_HUMANDisease (FH)730882100CL411V
078UniProtVAR_005385D433HLDLR_HUMANDisease (FH)121908036CD412H
079UniProtVAR_005386T434KLDLR_HUMANUnclassified (FH)  ---CT413K
080UniProtVAR_025455H417QPCSK9_HUMANPolymorphism143275858BH417Q
081UniProtVAR_005388I441MLDLR_HUMANUnclassified  ---CI420M
082UniProtVAR_005387I441NLDLR_HUMANPolymorphism879254862CI420N
083UniProtVAR_072848Y442HLDLR_HUMANUnclassified (FH)879254863CY421H
084UniProtVAR_005389W443CLDLR_HUMANPolymorphism879254867CW422C
085UniProtVAR_021337N425SPCSK9_HUMANPolymorphism28362261BN425S
086UniProtVAR_062380I451TLDLR_HUMANDisease (FH)879254874CI430T
087UniProtVAR_072849T454NLDLR_HUMANDisease (FH)879254879CT433N
088UniProtVAR_021338A443TPCSK9_HUMANPolymorphism28362263BA443T
089UniProtVAR_011863V468ILDLR_HUMANPolymorphism5932CV447I
090UniProtVAR_065783R471GLDLR_HUMANPolymorphism879254891CR450G
091UniProtVAR_058533G452DPCSK9_HUMANPolymorphism  ---BG452D
092UniProtVAR_005390G478RLDLR_HUMANPolymorphism144614838CG457R
093UniProtVAR_062381L479PLDLR_HUMANDisease (FH)879254900CL458P
094UniProtVAR_005391D482HLDLR_HUMANDisease (FH)  ---CD461H
095UniProtVAR_005392W483RLDLR_HUMANDisease (FH)879254905CW462R
096UniProtVAR_005394H485RLDLR_HUMANPolymorphism879254906CH464R
097UniProtVAR_025456R469WPCSK9_HUMANPolymorphism141502002BR469W
098UniProtVAR_072850D492NLDLR_HUMANUnclassified (FH)373646964CD471N
099UniProtVAR_021339V474IPCSK9_HUMANPolymorphism562556BI474I
100UniProtVAR_025457E482GPCSK9_HUMANPolymorphism141995194BE482G
101UniProtVAR_073657E482QPCSK9_HUMANUnclassified  ---BE482Q
102UniProtVAR_058534R496WPCSK9_HUMANDisease (HCHOLA3)374603772BR496W
103UniProtVAR_005395V523MLDLR_HUMANDisease (FH)28942080CV502M
104UniProtVAR_005396P526SLDLR_HUMANUnclassified (FH)730882106CP505S
105UniProtVAR_025458F515LPCSK9_HUMANPolymorphism  ---BF515L
106UniProtVAR_058535A522TPCSK9_HUMANPolymorphism777300852BA522T
107UniProtVAR_005397G546DLDLR_HUMANPolymorphism28942081CG525D
108UniProtVAR_005398G549DLDLR_HUMANDisease (FH)28941776CG528D
109UniProtVAR_005399N564HLDLR_HUMANDisease (FH)28942086CN543H
110UniProtVAR_005400N564SLDLR_HUMANDisease (FH)758194385CN543S
111UniProtVAR_005401G565VLDLR_HUMANPolymorphism28942082CG544V
112UniProtVAR_008996L568VLDLR_HUMANDisease (FH)  ---CL547V
113UniProtVAR_072851R574CLDLR_HUMANDisease (FH)185098634CR553C
114UniProtVAR_072852R574HLDLR_HUMANUnclassified (FH)777188764CR553H
115UniProtVAR_021340H553RPCSK9_HUMANPolymorphism28362270BH553R
116UniProtVAR_025459Q554EPCSK9_HUMANPolymorphism149311926BQ554E
117UniProtVAR_072853W577GLDLR_HUMANDisease (FH)879255000CW556G
118UniProtVAR_072854W577SLDLR_HUMANUnclassified (FH)138947766CW556S
119UniProtVAR_005402D579NLDLR_HUMANDisease (FH)  ---CD558N
120UniProtVAR_062382D579YLDLR_HUMANDisease (FH)875989929CD558Y
121UniProtVAR_072855I585TLDLR_HUMANUnclassified (FH)879255012CI564T
122UniProtVAR_005403G592ELDLR_HUMANDisease (FH)137929307CG571E
123UniProtVAR_072856R595WLDLR_HUMANUnclassified (FH)373371572CR574W
124UniProtVAR_005404L599SLDLR_HUMANPolymorphism879255025CL578S
125UniProtVAR_072857D601HLDLR_HUMANUnclassified (FH)  ---CD580H
126UniProtVAR_007989P608SLDLR_HUMANDisease (FH)879255034CP587S
127UniProtVAR_005405R633CLDLR_HUMANDisease (FH)746118995CR612C
128UniProtVAR_058536P616LPCSK9_HUMANPolymorphism755750316BP616L
129UniProtVAR_072858V639DLDLR_HUMANDisease (FH)794728584CV618D
130UniProtVAR_021341Q619PPCSK9_HUMANPolymorphism28362277BQ619P
131UniProtVAR_005406P649LLDLR_HUMANDisease (FH)879255081CP628L
132UniProtVAR_005407C667YLDLR_HUMANDisease (FH)28942083CC646Y
133UniProtVAR_005408C677RLDLR_HUMANDisease (FH)775092314CC656R
134UniProtVAR_005409L682PLDLR_HUMANPolymorphism879255119CL661P
135UniProtVAR_005410P685LLDLR_HUMANDisease (FH)28942084CP664L
136UniProtVAR_013955P699LLDLR_HUMANUnclassified (FH)201573863CP678L
137UniProtVAR_005412D700ELDLR_HUMANDisease (FH)759858813CD679E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (6, 13)

Asymmetric/Biological Unit (6, 13)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LDLRA_1PS01209 LDL-receptor class A (LDLRA) domain signature.LDLR_HUMAN39-63
82-104
121-143
160-184
209-231
248-270
289-313
  1-
-
-
-
-
-
C:268-292
2EGF_3PS50026 EGF-like domain profile.LDLR_HUMAN314-353
354-393
  2C:293-332
C:333-372
3ASX_HYDROXYLPS00010 Aspartic acid and asparagine hydroxylation site.LDLR_HUMAN329-340
368-379
  2C:308-319
C:347-358
4EGF_2PS01186 EGF-like domain signature 2.LDLR_HUMAN338-352
377-392
  2C:317-331
C:356-371
5EGF_CAPS01187 Calcium-binding EGF-like domain signature.LDLR_HUMAN354-377  1C:333-356
6LDLRBPS51120 LDL-receptor class B (LDLRB) repeat profile.LDLR_HUMAN439-485
486-528
529-572
573-617
618-658
  5C:418-464
C:465-507
C:508-551
C:552-596
C:597-637

(-) Exons   (12, 13)

Asymmetric/Biological Unit (12, 13)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003021181bENSE00001884398chr1:55505221-55505717497PCSK9_HUMAN1-69691A:61-69
-
9
-
1.2ENST000003021182ENSE00001279167chr1:55509516-55509707192PCSK9_HUMAN70-133641A:70-133
-
64
-
1.3ENST000003021183ENSE00001279161chr1:55512196-55512319124PCSK9_HUMAN134-175422A:134-152
B:153-167
19
15
1.4cENST000003021184cENSE00001279157chr1:55517951-55518084134PCSK9_HUMAN175-219451-
B:176-212
-
37
1.5ENST000003021185ENSE00001279150chr1:55518323-55518464142PCSK9_HUMAN220-267481-
B:220-267
-
48
1.6ENST000003021186ENSE00001279145chr1:55521666-55521862197PCSK9_HUMAN267-332661-
B:267-332
-
66
1.7aENST000003021187aENSE00001156685chr1:55523004-55523187184PCSK9_HUMAN333-394621-
B:333-394
-
62
1.8ENST000003021188ENSE00001139624chr1:55523709-55523882174PCSK9_HUMAN394-452591-
B:394-452 (gaps)
-
59
1.9ENST000003021189ENSE00001279131chr1:55524172-55524320149PCSK9_HUMAN452-501501-
B:452-501
-
50
1.10ENST0000030211810ENSE00001338737chr1:55525159-55525336178PCSK9_HUMAN502-561601-
B:502-561
-
60
1.11ENST0000030211811ENSE00001338722chr1:55527048-55527229182PCSK9_HUMAN561-621611-
B:561-621 (gaps)
-
61
1.12bENST0000030211812bENSE00001922690chr1:55529042-555305251484PCSK9_HUMAN622-692711-
B:622-682 (gaps)
-
61

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:92
 aligned with PCSK9_HUMAN | Q8NBP7 from UniProtKB/Swiss-Prot  Length:692

    Alignment length:92
                                    70        80        90       100       110       120       130       140       150  
          PCSK9_HUMAN    61 TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ 152
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------Inhibitor_I9-3m0cA01 A:77-152                                                Pfam domains
         Sec.struct. author ..eee...hhh.eeeeeeeeee....hhhhhhhhhhhhhhhhhhh....eeeeee.....eeeee.hhhhhhhhhh...eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------I---------------C------------R-------A------------R-G----------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1bExon 1.2  PDB: A:70-133 UniProt: 70-133                         Exon 1.3            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------- Transcript 1 (2)
                 3m0c A  61 TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ 152
                                    70        80        90       100       110       120       130       140       150  

Chain B from PDB  Type:PROTEIN  Length:486
 aligned with PCSK9_HUMAN | Q8NBP7 from UniProtKB/Swiss-Prot  Length:692

    Alignment length:530
                                   162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682
          PCSK9_HUMAN   153 SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSR 682
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------        -----Peptidase_S8-3m0cB01 B:181-443                                                                                                                                                                                                                                         ------  ------------------------------------------------------------------------------------------------------------------------            ---------------------------------  ---------------------  ------------------           ------------ Pfam domains
         Sec.struct. author ..hhhhhhh......--------.....eeeeee.............eeeeeee......-------....hhhhhhhhhhhhh.........eeeeee......eeehhhhhhhhhhhhhhhhhh....eeeee.eeee.hhhhhhhhhhhhhh..eeeee......hhh.ee.......eeeeee.......ee..ee........eeee...eeee......eeeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.ee...hhhhhhhhhh.....ee........--....eeeeee..........eeee......eeeeeeee.....eeeeeeeee..eeeeeeee.......eeeeeeee....eeeeeee........eeee......eeeeeeee......------------...eeee....eeeeeeee...eeeeeeeeee.--..eeeee.....eeeeeee..--..eeeeeee..eeeeee.-----------.eeeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) ----K-------------------------------------------------------------------------------W-D-------------F-------------------------------------------------------------------------------------------------------H----------------H----------------N--S----------------------Q-------S-----------------T--------D----------------W----I-------G-------------W------------------L------T------------------------------RE-------------------------------------------------------------L--P--------------------------------------------------------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y-----------------------------------------------------------------------------------------------------------Q-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: B:153-16--------------------------------------------Exon 1.5  PDB: B:220-267 UniProt: 220-267       -----------------------------------------------------------------Exon 1.7a  PDB: B:333-394 UniProt: 333-394                    ---------------------------------------------------------Exon 1.9  PDB: B:452-501 UniProt: 452-501         Exon 1.10  PDB: B:502-561 UniProt: 502-561                  ------------------------------------------------------------Exon 1.12b  PDB: B:622-682 (gaps) UniProt: 622-692            Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.4c  PDB: B:176-212 UniProt: 175-219   -----------------------------------------------Exon 1.6  PDB: B:267-332 UniProt: 267-332                         -------------------------------------------------------------Exon 1.8  PDB: B:394-452 (gaps) UniProt: 394-452           ------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: B:561-621 (gaps) UniProt: 561-621            ------------------------------------------------------------- Transcript 1 (2)
                 3m0c B 153 SIPWNLERITPPRYR--------GGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEED-------ASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSYCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTH--GWQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDL------------QPNQCVGHREASIHASCCHAPGLECKVKEHGIP--QEQVTVACEEGWTLTGCSALP--SHVLGAYAVDNTCVVRSR-----------AVTAVAICCRSR 682
                                   162    |    -   |   182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442      |452       462       472       482       492       502       512       522       532       542       552       562        |-         - |     592       602       612   |  |622       632      |642       652      |  -       672       682
                                        167      176                                 212     220                                                                                                                                                                                                                                  449  |                                                                                                                    571          584                             616  |                 639  |              659         671           
                                                                                                                                                                                                                                                                                                                                     452                                                                                                                                                                    619                    642                                        

Chain C from PDB  Type:PROTEIN  Length:430
 aligned with LDLR_HUMAN | P01130 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:438
                                   285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535       545       555       565       575       585       595       605       615       625       635       645       655       665       675       685       695       705        
           LDLR_HUMAN   276 CEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT 713
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) Ldl_recept_a-3m0cC07 C:255-292        ----------------------------------------EGF_CA-3m0cC06 C:333-371               -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Ldl_recept_b-3m0cC01 C:595-635           --------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Ldl_recept_b-3m0cC02 C:595-635           --------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Ldl_recept_b-3m0cC03 C:595-635           --------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Ldl_recept_b-3m0cC04 C:595-635           --------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Ldl_recept_b-3m0cC05 C:595-635           --------------------------------------------------------- Pfam domains (5)
         Sec.struct. author ............................................hhhhhh..eeee....eeee.....eee...eee.............................ee........ee.....eeeee....eeee.......eeee.....eeeeeee....eeeeee....eeeeee.--------.eeee........eeeee....eeeeee....eeeeee.....eeeeee.....eeeeeee....eeeeee.....eeeeee.....eeeee......eeeeeee....eeeeee....eeeeee......eeeee.......eeeeeee..eeeeee....eeeeee.......eeee........eeeehhhhh...........hhhhhh..eeee..........eeee.....ee......ee. Sec.struct. author
             SAPs(SNPs) (1) RK-------YR-K-----------GAW-E-L------YR---F-------CY-F-----S--S---ES------P-R-G-YKY-----R-R-R-T--D-----R-----------T-------D-H-LP-Q-K-----RGQ------T-----M-TVHK------MHC-------T--N-------------I--G------RP--HR-R------N------------------------------M--S-------------------D--D--------------HV--V-----C--G-N-----T------E--W---S-H------S------------------------C-----D---------L-----------------Y---------R----P--L-------------LE------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) W------------------------GY-N-------------R----------Y------------N---------Y-V-------------Y----------Y---------------------V----W---------W------------------------N--------------------------------------------------------------------------------------------------------------------------S---------H--S-Y-------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) Y-----------------------------------------Y----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                PROSITE (1) -------------LDLRA_1  PDB: C:268-292  EGF_3  PDB: C:293-332 UniProt: 314-353  EGF_3  PDB: C:333-372 UniProt: 354-393  ---------------------------------------------LDLRB  PDB: C:418-464 UniProt: 439-485         LDLRB  PDB: C:465-507 UniProt: 486-528     LDLRB  PDB: C:508-551 UniProt: 529-572      LDLRB  PDB: C:552-596 UniProt: 573-617       LDLRB  PDB: C:597-637 UniProt: 618-658   ------------------------------------------------------- PROSITE (1)
                PROSITE (2) -----------------------------------------------------ASX_HYDROXYL---------------------------ASX_HYDROXYL---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) --------------------------------------------------------------EGF_2          ------------------------EGF_2           --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) ------------------------------------------------------------------------------EGF_CA  PDB: C:333-356  ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE (4)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 3m0c C 255 CEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQL--------YDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLT 692
                                   264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434|      444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644       654       664       674       684        
                                                                                                                                                                                                              435      444                                                                                                                                                                                                                                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 3M0C)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3M0C)

(-) Pfam Domains  (5, 9)

Asymmetric/Biological Unit
(-)
Clan: EGF (60)

(-) Gene Ontology  (96, 111)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (PCSK9_HUMAN | Q8NBP7)
molecular function
    GO:0034185    apolipoprotein binding    Interacting selectively and non-covalently with an apolipoprotein, the protein component of a lipoprotein complex.
    GO:0034190    apolipoprotein receptor binding    Interacting selectively and non-covalently with an apolipoprotein receptor.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0030169    low-density lipoprotein particle binding    Interacting selectively and non-covalently with a low-density lipoprotein particle, a lipoprotein particle that is rich in cholesterol esters and low in triglycerides, is typically composed of APOB100 and APOE, and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm.
    GO:0050750    low-density lipoprotein particle receptor binding    Interacting selectively and non-covalently with a low-density lipoprotein receptor.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043621    protein self-association    Interacting selectively and non-covalently with a domain within the same polypeptide.
    GO:0030547    receptor inhibitor activity    The function of interacting (directly or indirectly) with receptors such that the proportion of receptors in the active form is decreased.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0019871    sodium channel inhibitor activity    Stops, prevents, or reduces the activity of a sodium channel.
    GO:0034189    very-low-density lipoprotein particle binding    Interacting selectively and non-covalently with a very-low-density lipoprotein particle, a triglyceride-rich lipoprotein particle that is typically composed of APOB100, APOE and APOCs and has a density of about 1.006 g/ml and a diameter of between 20-80 nm.
    GO:0070326    very-low-density lipoprotein particle receptor binding    Interacting selectively and non-covalently with a very-low-density lipoprotein receptor.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0032869    cellular response to insulin stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0009267    cellular response to starvation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0032802    low-density lipoprotein particle receptor catabolic process    The chemical reactions and pathways resulting in the breakdown of a low-density lipoprotein particle receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0032799    low-density lipoprotein receptor particle metabolic process    The chemical reactions and pathways involving low-density lipoprotein receptors.
    GO:0007041    lysosomal transport    The directed movement of substances into, out of or within a lysosome.
    GO:0010989    negative regulation of low-density lipoprotein particle clearance    Any process that decreases the rate, frequency or extent of low-density lipoprotein particle clearance. Low-density lipoprotein particle clearance is the process in which a low-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:2000272    negative regulation of receptor activity    Any process that stops, prevents or reduces the frequency, rate or extent of receptor activity.
    GO:0001920    negative regulation of receptor recycling    Any process that stops, prevents, or reduces the rate of receptor recycling.
    GO:2000650    negative regulation of sodium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transporter activity.
    GO:0022008    neurogenesis    Generation of cells within the nervous system.
    GO:0030182    neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
    GO:0006644    phospholipid metabolic process    The chemical reactions and pathways involving phospholipids, any lipid containing phosphoric acid as a mono- or diester.
    GO:0032805    positive regulation of low-density lipoprotein particle receptor catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of low-density lipoprotein particle receptors.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0002092    positive regulation of receptor internalization    Any process that activates or increases the frequency, rate or extent of receptor internalization.
    GO:0016540    protein autoprocessing    Processing which a protein carries out itself. This involves actions such as the autolytic removal of residues to generate the mature form of the protein.
    GO:0016485    protein processing    Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein. Protein maturation is the process leading to the attainment of the full functional capacity of a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0032803    regulation of low-density lipoprotein particle receptor catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of low-density lipoprotein particle receptors.
    GO:0043523    regulation of neuron apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process in neurons.
    GO:0010469    regulation of receptor activity    Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0006641    triglyceride metabolic process    The chemical reactions and pathways involving triglyceride, any triester of glycerol. The three fatty acid residues may all be the same or differ in any permutation. Triglycerides are important components of plant oils, animal fats and animal plasma lipoproteins.
cellular component
    GO:0030134    COPII-coated ER to Golgi transport vesicle    A vesicle with a coat formed of the COPII coat complex proteins. The COPII coat complex is formed by the Sec23p/Sec24p and the Sec13p/Sec31p heterodimers. COPII-associated vesicles transport proteins from the rough endoplasmic reticulum to the Golgi apparatus (anterograde transport).
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:1990667    PCSK9-AnxA2 complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and Annexin A2 (AnxA2).
    GO:1990666    PCSK9-LDLR complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and a low-density lipoprotein receptor (LDLR). Interaction typically occurs through the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR, and complex formation promotes degradation of the LDLR through the endosome/lysosome pathway.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005791    rough endoplasmic reticulum    The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

Chain C   (LDLR_HUMAN | P01130)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0032050    clathrin heavy chain binding    Interacting selectively and non-covalently with a clathrin heavy chain.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0030169    low-density lipoprotein particle binding    Interacting selectively and non-covalently with a low-density lipoprotein particle, a lipoprotein particle that is rich in cholesterol esters and low in triglycerides, is typically composed of APOB100 and APOE, and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm.
    GO:0005041    low-density lipoprotein receptor activity    Combining with a low-density lipoprotein particle and delivering the low-density lipoprotein into the cell via endocytosis.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0030229    very-low-density lipoprotein particle receptor activity    Combining with a very-low-density lipoprotein particle and delivering the very-low-density lipoprotein into the cell via endocytosis.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0070508    cholesterol import    The directed movement of cholesterol into a cell or organelle.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0030301    cholesterol transport    The directed movement of cholesterol, cholest-5-en-3-beta-ol, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0030299    intestinal cholesterol absorption    Uptake of cholesterol into the blood by absorption from the small intestine.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0006869    lipid transport    The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0042159    lipoprotein catabolic process    The chemical reactions and pathways resulting in the breakdown of any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0034383    low-density lipoprotein particle clearance    The process in which a low-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:0015914    phospholipid transport    The directed movement of phospholipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Phospholipids are any lipids containing phosphoric acid as a mono- or diester.
    GO:0010867    positive regulation of triglyceride biosynthetic process    Any process that increases the rate, frequency, or extent of triglyceride biosynthesis. Triglyceride biosynthesis is the collection of chemical reactions and pathways resulting in the formation of triglyceride, any triester of glycerol.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:2000188    regulation of cholesterol homeostasis    Any process that modulates the frequency, rate or extent of cholesterol homeostasis.
    GO:0010899    regulation of phosphatidylcholine catabolic process    Any process that modulates the rate, frequency or extent of phosphatidylcholine catabolism. Phosphatidylcholine catabolic processes are the chemical reactions and pathways resulting in the breakdown of phosphatidylcholines, any of a class of glycerophospholipids in which the phosphatidyl group is esterified to the hydroxyl group of choline.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:1990666    PCSK9-LDLR complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and a low-density lipoprotein receptor (LDLR). Interaction typically occurs through the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR, and complex formation promotes degradation of the LDLR through the endosome/lysosome pathway.
    GO:0045177    apical part of cell    The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0030669    clathrin-coated endocytic vesicle membrane    The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0012505    endomembrane system    A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0034362    low-density lipoprotein particle    A lipoprotein particle, rich in cholesterol esters and low in triglycerides that is typically composed of APOB100 and APOE and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm. LDL particles are formed from VLDL particles (via IDL) by the loss of triglyceride and gain of cholesterol ester. They transport endogenous cholesterol (and to some extent triglycerides) from peripheral tissues back to the liver.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asp C:339 - Pro C:340   [ RasMol ]  
    Ser B:326 - Pro B:327   [ RasMol ]  
    Val C:643 - Asn C:644   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3m0c
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LDLR_HUMAN | P01130
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  PCSK9_HUMAN | Q8NBP7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  143890
    Disease InformationOMIM
  603776
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  LDLR_HUMAN | P01130
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  PCSK9_HUMAN | Q8NBP7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LDLR_HUMAN | P011301ajj 1d2j 1f5y 1f8z 1hj7 1hz8 1i0u 1ijq 1ldl 1ldr 1lrx 1n7d 1xfe 2fcw 2kri 2lgp 2m7p 2mg9 2w2m 2w2n 2w2o 2w2p 2w2q 3bps 3gcw 3gcx 3p5b 3p5c 3so6 4ne9
        PCSK9_HUMAN | Q8NBP72p4e 2pmw 2qtw 2w2m 2w2n 2w2o 2w2p 2w2q 2xtj 3bps 3gcw 3gcx 3h42 3p5b 3p5c 3sqo 4k8r 4ne9 4nmx 4ov6

(-) Related Entries Specified in the PDB File

1ijq 1n7d 2qtw 3gcx