Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  RXFP1 UTILISES HYDROPHOBIC MOIETIES ON A SIGNALLING SURFACE OF THE LDLA MODULE TO MEDIATE RECEPTOR ACTIVATION
 
Authors :  R. Ck. Kong, E. J. Petrie, B. Mohanty, J. Ling, J. C. Y. Lee, P. R. Gooley, R. A. D. Bathgate
Date :  29 Apr 13  (Deposition) - 14 Aug 13  (Release) - 14 Aug 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Rxfp1, Relaxin, Ldla, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. C. K. Kong, E. J. Petrie, B. Mohanty, J. Ling, J. C. Y. Lee, P. R. Gooley R. A. D. Bathgate
The Relaxin Receptor (Rxfp1) Utilises Hydrophobic Moieties On A Signalling Surface Of Its N-Terminal Low Density Lipoprotein Class A Module To Mediate Receptor Activation
J. Biol. Chem. 2013
PubMed: search  |  Reference-DOI: 10.1074/JBC.M113.499640

(-) Compounds

Molecule 1 - LOW-DENSITY LIPOPROTEIN RECEPTOR, RELAXIN RECEPTOR 1
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Expression System Vector: PGEV-LB2
    Expression System Vector Type: VECTOR
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Other Details: CHIMERA PROTEIN OF THE LOW DENSITY LIPROPROTEIN RECEPTOR (LDLR_HUMAN, UNP P01130) AND RELAXIN RECEPTOR 1(RXFP1_HUMAN, UNP Q9HBX9).
    Synonym: LDL RECEPTOR, LEUCINE-RICH REPEAT-CONTAINING G-PROTEIN COUPLED RECEPTOR 7, RELAXIN FAMILY PEPTIDE RECEPTOR 1

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1CA1Ligand/IonCALCIUM ION
NMR Structure * (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION

(-) Sites  (1, 1)

NMR Structure (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETRP A:25 , ASP A:28 , GLN A:30 , ASP A:32 , ASP A:38 , GLU A:39BINDING SITE FOR RESIDUE CA A 101

(-) SS Bonds  (3, 3)

NMR Structure
No.Residues
1A:7 -A:20
2A:14 -A:33
3A:27 -A:42

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2M7P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (9, 9)

NMR Structure (9, 9) NMR Structure * (9, 9)

(-) PROSITE Motifs  (2, 3)

NMR Structure (2, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LDLRA_2PS50068 LDL-receptor class A (LDLRA) domain profile.LDLR_HUMAN26-64
67-105
108-144
147-185
196-232
235-271
275-314		  1-
A:6-42
-
-
-
-
-
RXFP1_HUMAN26-63  1A:7-42
2LDLRA_1PS01209 LDL-receptor class A (LDLRA) domain signature.LDLR_HUMAN39-63
82-104
121-143
160-184
209-231
248-270
289-313		  1-
A:20-42
-
-
-
-
-
RXFP1_HUMAN40-62  1A:20-42
NMR Structure * (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1LDLRA_2PS50068 LDL-receptor class A (LDLRA) domain profile.LDLR_HUMAN26-64
67-105
108-144
147-185
196-232
235-271
275-314		  1-
A:6-42
-
-
-
-
-
RXFP1_HUMAN26-63  1A:7-42
2LDLRA_1PS01209 LDL-receptor class A (LDLRA) domain signature.LDLR_HUMAN39-63
82-104
121-143
160-184
209-231
248-270
289-313		  1-
A:20-42
-
-
-
-
-
RXFP1_HUMAN40-62  1A:20-42

(-) Exons   (1, 1)

NMR Structure (1, 1)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.4aENST000003077654aENSE00002201510chr4:159442878-159443177300RXFP1_HUMAN1-17170--
1.7aENST000003077657aENSE00001725025chr4:159493850-159493987138RXFP1_HUMAN17-63471A:1-4242
1.8ENST000003077658ENSE00001786506chr4:159514553-15951465199RXFP1_HUMAN63-96340--
1.9bENST000003077659bENSE00001126785chr4:159520478-159520583106RXFP1_HUMAN96-131360--
1.10ENST0000030776510ENSE00001126775chr4:159526220-15952629172RXFP1_HUMAN131-155250--
1.12ENST0000030776512ENSE00001126766chr4:159529124-15952919572RXFP1_HUMAN155-179250--
1.14ENST0000030776514ENSE00001126758chr4:159533282-15953335372RXFP1_HUMAN179-203250--
1.15ENST0000030776515ENSE00001126752chr4:159533443-15953351472RXFP1_HUMAN203-227250--
1.16ENST0000030776516ENSE00001126746chr4:159538283-15953835775RXFP1_HUMAN227-252260--
1.17ENST0000030776517ENSE00001126740chr4:159547972-15954804372RXFP1_HUMAN252-276250--
1.18ENST0000030776518ENSE00001126735chr4:159549790-15954986172RXFP1_HUMAN276-300250--
1.19ENST0000030776519ENSE00001126730chr4:159554557-15955462872RXFP1_HUMAN300-324250--
1.20ENST0000030776520ENSE00001126726chr4:159559160-15955923172RXFP1_HUMAN324-348250--
1.21ENST0000030776521ENSE00001126719chr4:159560412-15956048372RXFP1_HUMAN348-372250--
1.22ENST0000030776522ENSE00001126712chr4:159566061-159566290230RXFP1_HUMAN372-449780--
1.24ENST0000030776524ENSE00001126705chr4:159567943-159568353411RXFP1_HUMAN449-5861380--
1.25ENST0000030776525ENSE00001126696chr4:159569651-159569869219RXFP1_HUMAN586-659740--
1.26dENST0000030776526dENSE00001905889chr4:159572909-1595745241616RXFP1_HUMAN659-757990--

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:42
 aligned with LDLR_HUMAN | P01130 from UniProtKB/Swiss-Prot  Length:860

    Alignment length:57
                                    57        67        77        87        97       
           LDLR_HUMAN    48 GSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC 104
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author ..---..-----------......ee...-.....ee.hhh.........hhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ------------------------------C--------G-YG-E--G-----K--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------------------------------------------N-------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ------------------------------------------Y-------------- SAPs(SNPs) (3)
                PROSITE (2) LDLRA_2  PDB: -  -----------------LDLRA_1  PDB: A:20-42   PROSITE (2)
                PROSITE (3) LDLRA_1  PDB: - ----------------------------------------- PROSITE (3)
                PROSITE (1) -------------------LDLRA_2  PDB: A:6-42 UniProt: 67-105   PROSITE (1)
                 Transcript --------------------------------------------------------- Transcript
                 2m7p A   1 GS---QD-----------VTCSLGYFPCG-NITKCIPQFWRCDGQVDCDNGSDEQGC  42
                             |   ||  -        |6        |-|       25        35       
                             2   3|           5        15 |                          
                                  4                      16                          


Chain A from PDB  Type:PROTEIN  Length:42
 aligned with RXFP1_HUMAN | Q9HBX9 from UniProtKB/Swiss-Prot  Length:757

    Alignment length:42
                                    30        40        50        60  
          RXFP1_HUMAN    21 GGQDVKCSLGYFPCGNITKCLPQLLHCNGVDDCGNQADEDNC  62
               SCOP domains ------------------------------------------ SCOP domains
               CATH domains ------------------------------------------ CATH domains
               Pfam domains ------------------------------------------ Pfam domains
         Sec.struct. author ..........ee........ee.hhh.........hhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---------------C--------G-YG-E--G-----K--- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------N-------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---------------------------Y-------------- SAPs(SNPs) (3)
                PROSITE (1) -----LDLRA_2  PDB: A:7-42 UniProt: 26-63   PROSITE (1)
                PROSITE (2) ------------------------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------ PROSITE (3)
                PROSITE (4) -------------------LDLRA_1  PDB: A:20-42   PROSITE (4)
               Transcript 1 Exon 1.7a  PDB: A:1-42 UniProt: 17-63      Transcript 1
                 2m7p A   1 GSQDVTCSLGYFPCGNITKCIPQFWRCDGQVDCDNGSDEQGC  42
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2M7P)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2M7P)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2M7P)

(-) Gene Ontology  (56, 60)

NMR Structure(hide GO term definitions)
Chain A   (RXFP1_HUMAN | Q9HBX9)
molecular function
    GO:0004930    G-protein coupled receptor activity    Combining with an extracellular signal and transmitting the signal across the membrane by activating an associated G-protein; promotes the exchange of GDP for GTP on the alpha subunit of a heterotrimeric G-protein complex.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004871    signal transducer activity    Conveys a signal across a cell to trigger a change in cell function or state. A signal is a physical entity or change in state that is used to transfer information in order to trigger a response.
biological process
    GO:0007186    G-protein coupled receptor signaling pathway    A series of molecular signals that proceeds with an activated receptor promoting the exchange of GDP for GTP on the alpha-subunit of an associated heterotrimeric G-protein complex. The GTP-bound activated alpha-G-protein then dissociates from the beta- and gamma-subunits to further transmit the signal within the cell. The pathway begins with receptor-ligand interaction, or for basal GPCR signaling the pathway begins with the receptor activating its G protein in the absence of an agonist, and ends with regulation of a downstream cellular process, e.g. transcription. The pathway can start from the plasma membrane, Golgi or nuclear membrane (PMID:24568158 and PMID:16902576).
    GO:0007188    adenylate cyclase-modulating G-protein coupled receptor signaling pathway    The series of molecular signals generated as a consequence of a G-protein coupled receptor binding to its physiological ligand, where the pathway proceeds through activation or inhibition of adenylyl cyclase activity and a subsequent change in the concentration of cyclic AMP (cAMP).
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A   (LDLR_HUMAN | P01130)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0032050    clathrin heavy chain binding    Interacting selectively and non-covalently with a clathrin heavy chain.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0030169    low-density lipoprotein particle binding    Interacting selectively and non-covalently with a low-density lipoprotein particle, a lipoprotein particle that is rich in cholesterol esters and low in triglycerides, is typically composed of APOB100 and APOE, and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm.
    GO:0005041    low-density lipoprotein receptor activity    Combining with a low-density lipoprotein particle and delivering the low-density lipoprotein into the cell via endocytosis.
    GO:0002020    protease binding    Interacting selectively and non-covalently with any protease or peptidase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0004872    receptor activity    Combining with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0030229    very-low-density lipoprotein particle receptor activity    Combining with a very-low-density lipoprotein particle and delivering the very-low-density lipoprotein into the cell via endocytosis.
    GO:0001618    virus receptor activity    Combining with a virus component and mediating entry of the virus into the cell.
biological process
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0070508    cholesterol import    The directed movement of cholesterol into a cell or organelle.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0030301    cholesterol transport    The directed movement of cholesterol, cholest-5-en-3-beta-ol, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006897    endocytosis    A vesicle-mediated transport process in which cells take up external materials or membrane constituents by the invagination of a small region of the plasma membrane to form a new membrane-bounded vesicle.
    GO:0030299    intestinal cholesterol absorption    Uptake of cholesterol into the blood by absorption from the small intestine.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0006869    lipid transport    The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0042159    lipoprotein catabolic process    The chemical reactions and pathways resulting in the breakdown of any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0034383    low-density lipoprotein particle clearance    The process in which a low-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:0015914    phospholipid transport    The directed movement of phospholipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Phospholipids are any lipids containing phosphoric acid as a mono- or diester.
    GO:0010867    positive regulation of triglyceride biosynthetic process    Any process that increases the rate, frequency, or extent of triglyceride biosynthesis. Triglyceride biosynthesis is the collection of chemical reactions and pathways resulting in the formation of triglyceride, any triester of glycerol.
    GO:0006898    receptor-mediated endocytosis    An endocytosis process in which cell surface receptors ensure specificity of transport. A specific receptor on the cell surface binds tightly to the extracellular macromolecule (the ligand) that it recognizes; the plasma-membrane region containing the receptor-ligand complex then undergoes endocytosis, forming a transport vesicle containing the receptor-ligand complex and excluding most other plasma-membrane proteins. Receptor-mediated endocytosis generally occurs via clathrin-coated pits and vesicles.
    GO:2000188    regulation of cholesterol homeostasis    Any process that modulates the frequency, rate or extent of cholesterol homeostasis.
    GO:0010899    regulation of phosphatidylcholine catabolic process    Any process that modulates the rate, frequency or extent of phosphatidylcholine catabolism. Phosphatidylcholine catabolic processes are the chemical reactions and pathways resulting in the breakdown of phosphatidylcholines, any of a class of glycerophospholipids in which the phosphatidyl group is esterified to the hydroxyl group of choline.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:1990666    PCSK9-LDLR complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and a low-density lipoprotein receptor (LDLR). Interaction typically occurs through the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR, and complex formation promotes degradation of the LDLR through the endosome/lysosome pathway.
    GO:0045177    apical part of cell    The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
    GO:0016323    basolateral plasma membrane    The region of the plasma membrane that includes the basal end and sides of the cell. Often used in reference to animal polarized epithelial membranes, where the basal membrane is the part attached to the extracellular matrix, or in plant cells, where the basal membrane is defined with respect to the zygotic axis.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0030669    clathrin-coated endocytic vesicle membrane    The lipid bilayer surrounding a clathrin-coated endocytic vesicle.
    GO:0005905    clathrin-coated pit    A part of the endomembrane system in the form of an invagination of a membrane upon which a clathrin coat forms, and that can be converted by vesicle budding into a clathrin-coated vesicle. Coated pits form on the plasma membrane, where they are involved in receptor-mediated selective transport of many proteins and other macromolecules across the cell membrane, in the trans-Golgi network, and on some endosomes.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0012505    endomembrane system    A collection of membranous structures involved in transport within the cell. The main components of the endomembrane system are endoplasmic reticulum, Golgi bodies, vesicles, cell membrane and nuclear envelope. Members of the endomembrane system pass materials through each other or though the use of vesicles.
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0010008    endosome membrane    The lipid bilayer surrounding an endosome.
    GO:0009897    external side of plasma membrane    The leaflet of the plasma membrane that faces away from the cytoplasm and any proteins embedded or anchored in it or attached to its surface.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0034362    low-density lipoprotein particle    A lipoprotein particle, rich in cholesterol esters and low in triglycerides that is typically composed of APOB100 and APOE and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm. LDL particles are formed from VLDL particles (via IDL) by the loss of triglyceride and gain of cholesterol ester. They transport endogenous cholesterol (and to some extent triglycerides) from peripheral tissues back to the liver.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0043235    receptor complex    Any protein complex that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2m7p)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - model 1, sites PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2m7p
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LDLR_HUMAN | P01130
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  RXFP1_HUMAN | Q9HBX9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  143890
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LDLR_HUMAN | P01130
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  RXFP1_HUMAN | Q9HBX9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LDLR_HUMAN | P01130: 1ajj 1d2j 1f5y 1f8z 1hj7 1hz8 1i0u 1ijq 1ldl 1ldr 1lrx 1n7d 1xfe 2fcw 2kri 2lgp 2mg9 2w2m 2w2n 2w2o 2w2p 2w2q 3bps 3gcw 3gcx 3m0c 3p5b 3p5c 3so6 4ne9
        RXFP1_HUMAN | Q9HBX9: 2jm4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2M7P)