Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  PCSK9 J16 FAB COMPLEX
 
Authors :  P. Strop
Date :  05 Jul 11  (Deposition) - 16 May 12  (Release) - 16 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym./Biol. Unit :  A,H,L,P
Keywords :  Cholesterol Regulation, Ldlr, Hydrolase-Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  H. Liang, J. Chaparro-Riggers, P. Strop, T. Geng, J. E. Sutton, D. Tsai L. Bai, Y. Abdiche, J. Dilley, J. Yu, S. Wu, S. M. Chin, N. A. Lee, A. Rossi J. C. Lin, A. Rajpal, J. Pons, D. L. Shelton
Proprotein Convertase Substilisin/Kexin Type 9 Antagonism Reduces Low-Density Lipoprotein Cholesterol In Statin-Treated Hypercholesterolemic Nonhuman Primates.
J. Pharmacol. Exp. Ther. V. 340 228 2012
PubMed-ID: 22019884  |  Reference-DOI: 10.1124/JPET.111.187419

(-) Compounds

Molecule 1 - PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
    ChainsA
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System Taxid9606
    GenePCSK9, NARC1, PSEC0052
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9
 
Molecule 2 - J16 HEAVY CHAIN
    ChainsH
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System Taxid9606
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 3 - J16 LIGHT CHAIN
    ChainsL
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System Taxid9606
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
 
Molecule 4 - PCSK9 PRODOMAIN
    ChainsP
    EC Number3.4.21.-
    EngineeredYES
    Expression SystemHOMO SAPIENS
    Expression System Cell LineHEK293
    Expression System Taxid9606
    GenePCSK9, NARC1, PSEC0052
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymNEURAL APOPTOSIS-REGULATED CONVERTASE 1, NARC-1, PROPROTEIN CONVERTASE 9, PC9, SUBTILISIN/KEXIN-LIKE PROTEASE PC9

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit AHLP

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 3SQO)

(-) Sites  (0, 0)

(no "Site" information available for 3SQO)

(-) SS Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1A:223 -A:255
2A:323 -A:358
3A:375 -A:378
4A:457 -A:527
5A:477 -A:526
6A:486 -A:509
7A:534 -A:601
8A:552 -A:600
9A:562 -A:588
10A:608 -A:679
11A:626 -A:678
12A:635 -A:654
13H:22 -H:92
14H:144 -H:200
15L:23 -L:88
16L:134 -L:194

(-) Cis Peptide Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1Ser A:326 -Pro A:327
2Phe H:150 -Pro H:151
3Glu H:152 -Pro H:153
4Ser L:7 -Pro L:8
5Tyr L:140 -Pro L:141

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (31, 31)

Asymmetric/Biological Unit (31, 31)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_058520T77IPCSK9_HUMANPolymorphism756060557PT77I
02UniProtVAR_058521R93CPCSK9_HUMANPolymorphism151193009PR93C
03UniProtVAR_058522G106RPCSK9_HUMANPolymorphism  ---PG106R
04UniProtVAR_058523V114APCSK9_HUMANPolymorphism775988212PV114A
05UniProtVAR_017199S127RPCSK9_HUMANDisease (HCHOLA3)28942111PS127R
06UniProtVAR_058524D129GPCSK9_HUMANDisease (HCHOLA3)  ---PD129G
07UniProtVAR_058525N157KPCSK9_HUMANPolymorphism143117125AN157K
08UniProtVAR_058528Q219EPCSK9_HUMANPolymorphism778617372AQ219E
09UniProtVAR_025452R237WPCSK9_HUMANPolymorphism148195424AR237W
10UniProtVAR_058529A239DPCSK9_HUMANPolymorphism  ---AA239D
11UniProtVAR_025453L253FPCSK9_HUMANPolymorphism28362270AL253F
12UniProtVAR_058530R357HPCSK9_HUMANDisease (HCHOLA3)370507566AR357H
13UniProtVAR_058531D374HPCSK9_HUMANDisease (HCHOLA3)  ---AD374H
14UniProtVAR_058532D374YPCSK9_HUMANDisease (HCHOLA3)137852912AD374Y
15UniProtVAR_025454H391NPCSK9_HUMANPolymorphism146471967AH391N
16UniProtVAR_067282G394SPCSK9_HUMANUnclassified368257906AG394S
17UniProtVAR_025455H417QPCSK9_HUMANPolymorphism143275858AH417Q
18UniProtVAR_021337N425SPCSK9_HUMANPolymorphism28362261AN425S
19UniProtVAR_021338A443TPCSK9_HUMANPolymorphism28362263AA443T
20UniProtVAR_025456R469WPCSK9_HUMANPolymorphism141502002AR469W
21UniProtVAR_021339V474IPCSK9_HUMANPolymorphism562556AI474I
22UniProtVAR_025457E482GPCSK9_HUMANPolymorphism141995194AE482G
23UniProtVAR_073657E482QPCSK9_HUMANUnclassified  ---AE482Q
24UniProtVAR_058534R496WPCSK9_HUMANDisease (HCHOLA3)374603772AR496W
25UniProtVAR_025458F515LPCSK9_HUMANPolymorphism  ---AF515L
26UniProtVAR_058535A522TPCSK9_HUMANPolymorphism777300852AA522T
27UniProtVAR_021340H553RPCSK9_HUMANPolymorphism28362270AH553R
28UniProtVAR_025459Q554EPCSK9_HUMANPolymorphism149311926AQ554E
29UniProtVAR_058536P616LPCSK9_HUMANPolymorphism755750316AP616L
30UniProtVAR_021341Q619PPCSK9_HUMANPolymorphism28362277AQ619P
31UniProtVAR_017201G670EPCSK9_HUMANPolymorphism505151AE670E

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 3SQO)

(-) Exons   (12, 13)

Asymmetric/Biological Unit (12, 13)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1bENST000003021181bENSE00001884398chr1:55505221-55505717497PCSK9_HUMAN1-69691-
P:61-69
-
9
1.2ENST000003021182ENSE00001279167chr1:55509516-55509707192PCSK9_HUMAN70-133641-
P:70-133
-
64
1.3ENST000003021183ENSE00001279161chr1:55512196-55512319124PCSK9_HUMAN134-175422A:153-168
P:134-152
16
19
1.4cENST000003021184cENSE00001279157chr1:55517951-55518084134PCSK9_HUMAN175-219451A:176-219 (gaps)
-
44
-
1.5ENST000003021185ENSE00001279150chr1:55518323-55518464142PCSK9_HUMAN220-267481A:220-267
-
48
-
1.6ENST000003021186ENSE00001279145chr1:55521666-55521862197PCSK9_HUMAN267-332661A:267-332
-
66
-
1.7aENST000003021187aENSE00001156685chr1:55523004-55523187184PCSK9_HUMAN333-394621A:333-394
-
62
-
1.8ENST000003021188ENSE00001139624chr1:55523709-55523882174PCSK9_HUMAN394-452591A:394-450
-
57
-
1.9ENST000003021189ENSE00001279131chr1:55524172-55524320149PCSK9_HUMAN452-501501A:453-501
-
49
-
1.10ENST0000030211810ENSE00001338737chr1:55525159-55525336178PCSK9_HUMAN502-561601A:502-561
-
60
-
1.11ENST0000030211811ENSE00001338722chr1:55527048-55527229182PCSK9_HUMAN561-621611A:561-621 (gaps)
-
61
-
1.12bENST0000030211812bENSE00001922690chr1:55529042-555305251484PCSK9_HUMAN622-692711A:622-681 (gaps)
-
60
-

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:491
 aligned with PCSK9_HUMAN | Q8NBP7 from UniProtKB/Swiss-Prot  Length:692

    Alignment length:529
                                   162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672         
         PCSK9_HUMAN    153 SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHGAGWQLFCRTVWSAHSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRS  681
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh......-------.....eeeeee.............eeeeeee.....-------hhhhhhhhhhhhhhhhhh.........eeeeee......eeehhhhhhhhhhhhhhhhhh....eeeee.eeee.hhhhhhhhhhhhhhh.eeeee......hhh.ee.......eeeeee.....................eeee...eeee.......eeee.hhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh.ee...hhhhhhhhhh.....ee.........--....eeeee...........eee......eeeeeeee.....eeeeeeee....eeeeeee.......eeeeeee....eeeeeeee........eeee.....eeeeeeeee.......------------..eeee....eeeeeeee....eeeeeeeeee....eeeee.....eeeeeee......eeeeeee..eeeeee.----------.eeeeeeeeee. Sec.struct. author
             SAPs(SNPs) (1) ----K-------------------------------------------------------------E-----------------W-D-------------F-------------------------------------------------------------------------------------------------------H----------------H----------------N--S----------------------Q-------S-----------------T-------------------------W----I-------G-------------W------------------L------T------------------------------RE-------------------------------------------------------------L--P--------------------------------------------------E----------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y-----------------------------------------------------------------------------------------------------------Q------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (2)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:153-16--------------------------------------------Exon 1.5  PDB: A:220-267 UniProt: 220-267       -----------------------------------------------------------------Exon 1.7a  PDB: A:333-394 UniProt: 333-394                    ---------------------------------------------------------Exon 1.9  PDB: A:453-501 UniProt: 452-501         Exon 1.10  PDB: A:502-561 UniProt: 502-561                  ------------------------------------------------------------Exon 1.12b  PDB: A:622-681 (gaps) UniProt: 622-692           Transcript 1 (1)
           Transcript 1 (2) ----------------------Exon 1.4c  PDB: A:176-219 (gaps) [INCOMPLETE]-----------------------------------------------Exon 1.6  PDB: A:267-332 UniProt: 267-332                         -------------------------------------------------------------Exon 1.8  PDB: A:394-450 UniProt: 394-452 [INCOMPLETE]     ------------------------------------------------------------------------------------------------------------Exon 1.11  PDB: A:561-621 (gaps) UniProt: 561-621            ------------------------------------------------------------ Transcript 1 (2)
                3sqo A  153 SIPWNLERITPPRYRA-------GGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEE-------QASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTHG--WQLFCRTVWSAHSGPTRMATAIARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLG------------PNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSR----------EAVTAVAICCRS  681
                                   162     |   -   |   182       192       202        |-      |222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       | -|      462       472       482       492       502       512       522       532       542       552       562       572         -  |    592       602       612       622       632       642       652      |  -       672         
                                         168     176                                211     219                                                                                                                                                                                                                                    450  |                                                                                                                    572          585                                                                       659        670           
                                                                                                                                                                                                                                                                                                                                      453                                                                                                                                                                                                                                    

Chain H from PDB  Type:PROTEIN  Length:211
                                                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee...eee.....eee.eeee..hhhhheeeeeeee...eeeeeeee.hhhh.eee........eeeee....eeeeee...hhhhheeeeeeee.......ee...eeeee.......eeeee......eeeeeeeee.....eeee........eee...ee.....eeeeeeee..........eeeeeee....eeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3sqo H    1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGEISPFGGRTNYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARERPLYASDLWGQGTTVTVSSATKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVER  217
                                    10        20        30        40        50  |     59        69        79   |||  86        96    |  105       120       130 ||    146       156       166       176       186       196       206       216 
                                                                              52A                            82A||               100A           114|         132|                                                                              
                                                                                                              82B|                               120          139                                                                              
                                                                                                               82C                                                                                                                             

Chain L from PDB  Type:PROTEIN  Length:213
                                                                                                                                                                                                                                                      
               SCOP domains d3sqol1 L:2-107 automated matches                                                                         d3sqol2 L:108-214 automated matches                                                                         SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeee..eeeee....eeeeeee.......eeeeee......eeeee...ee.......eeeeee..eeeeee...hhhhh.eeeeee......ee...eeeeee......eeeee..hhhhhhh.eeeeeeeeeee.....eeeeee..ee....eeeee.........eeeeeeeeeehhhhhh..eeeeeee.......eeeeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                3sqo L    2 IQMTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYSASYRYTGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQRYSLWRTFGQGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGES  214
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211   

Chain P from PDB  Type:PROTEIN  Length:92
 aligned with PCSK9_HUMAN | Q8NBP7 from UniProtKB/Swiss-Prot  Length:692

    Alignment length:92
                                    70        80        90       100       110       120       130       140       150  
         PCSK9_HUMAN     61 TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ  152
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee...hhh.eeeeeeeeee....hhhhhhhhhhhhhhhhhh.....eeeeee.....eeeee.hhhhhhhhh....eeeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------I---------------C------------R-------A------------R-G----------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1bExon 1.2  PDB: P:70-133 UniProt: 70-133                         Exon 1.3            Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------------------------------------- Transcript 1 (2)
                3sqo P   61 TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ  152
                                    70        80        90       100       110       120       130       140       150  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 3SQO)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 3SQO)

(-) Gene Ontology  (61, 61)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,P   (PCSK9_HUMAN | Q8NBP7)
molecular function
    GO:0034185    apolipoprotein binding    Interacting selectively and non-covalently with an apolipoprotein, the protein component of a lipoprotein complex.
    GO:0034190    apolipoprotein receptor binding    Interacting selectively and non-covalently with an apolipoprotein receptor.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0030169    low-density lipoprotein particle binding    Interacting selectively and non-covalently with a low-density lipoprotein particle, a lipoprotein particle that is rich in cholesterol esters and low in triglycerides, is typically composed of APOB100 and APOE, and has a density of 1.02-1.06 g/ml and a diameter of between 20-25 nm.
    GO:0050750    low-density lipoprotein particle receptor binding    Interacting selectively and non-covalently with a low-density lipoprotein receptor.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0043621    protein self-association    Interacting selectively and non-covalently with a domain within the same polypeptide.
    GO:0030547    receptor inhibitor activity    The function of interacting (directly or indirectly) with receptors such that the proportion of receptors in the active form is decreased.
    GO:0004252    serine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0008236    serine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a catalytic mechanism that involves a catalytic triad consisting of a serine nucleophile that is activated by a proton relay involving an acidic residue (e.g. aspartate or glutamate) and a basic residue (usually histidine).
    GO:0019871    sodium channel inhibitor activity    Stops, prevents, or reduces the activity of a sodium channel.
    GO:0034189    very-low-density lipoprotein particle binding    Interacting selectively and non-covalently with a very-low-density lipoprotein particle, a triglyceride-rich lipoprotein particle that is typically composed of APOB100, APOE and APOCs and has a density of about 1.006 g/ml and a diameter of between 20-80 nm.
    GO:0070326    very-low-density lipoprotein particle receptor binding    Interacting selectively and non-covalently with a very-low-density lipoprotein receptor.
biological process
    GO:0006915    apoptotic process    A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
    GO:0032869    cellular response to insulin stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an insulin stimulus. Insulin is a polypeptide hormone produced by the islets of Langerhans of the pancreas in mammals, and by the homologous organs of other organisms.
    GO:0009267    cellular response to starvation    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of deprivation of nourishment.
    GO:0042632    cholesterol homeostasis    Any process involved in the maintenance of an internal steady state of cholesterol within an organism or cell.
    GO:0008203    cholesterol metabolic process    The chemical reactions and pathways involving cholesterol, cholest-5-en-3 beta-ol, the principal sterol of vertebrates and the precursor of many steroids, including bile acids and steroid hormones. It is a component of the plasma membrane lipid bilayer and of plasma lipoproteins and can be found in all animal tissues.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0042157    lipoprotein metabolic process    The chemical reactions and pathways involving any conjugated, water-soluble protein in which the covalently attached nonprotein group consists of a lipid or lipids.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0032802    low-density lipoprotein particle receptor catabolic process    The chemical reactions and pathways resulting in the breakdown of a low-density lipoprotein particle receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
    GO:0032799    low-density lipoprotein receptor particle metabolic process    The chemical reactions and pathways involving low-density lipoprotein receptors.
    GO:0007041    lysosomal transport    The directed movement of substances into, out of or within a lysosome.
    GO:0010989    negative regulation of low-density lipoprotein particle clearance    Any process that decreases the rate, frequency or extent of low-density lipoprotein particle clearance. Low-density lipoprotein particle clearance is the process in which a low-density lipoprotein particle is removed from the blood via receptor-mediated endocytosis and its constituent parts degraded.
    GO:2000272    negative regulation of receptor activity    Any process that stops, prevents or reduces the frequency, rate or extent of receptor activity.
    GO:0001920    negative regulation of receptor recycling    Any process that stops, prevents, or reduces the rate of receptor recycling.
    GO:2000650    negative regulation of sodium ion transmembrane transporter activity    Any process that stops, prevents or reduces the frequency, rate or extent of sodium ion transmembrane transporter activity.
    GO:0022008    neurogenesis    Generation of cells within the nervous system.
    GO:0030182    neuron differentiation    The process in which a relatively unspecialized cell acquires specialized features of a neuron.
    GO:0006644    phospholipid metabolic process    The chemical reactions and pathways involving phospholipids, any lipid containing phosphoric acid as a mono- or diester.
    GO:0032805    positive regulation of low-density lipoprotein particle receptor catabolic process    Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of low-density lipoprotein particle receptors.
    GO:0043525    positive regulation of neuron apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death of neurons by apoptotic process.
    GO:0002092    positive regulation of receptor internalization    Any process that activates or increases the frequency, rate or extent of receptor internalization.
    GO:0016540    protein autoprocessing    Processing which a protein carries out itself. This involves actions such as the autolytic removal of residues to generate the mature form of the protein.
    GO:0016485    protein processing    Any protein maturation process achieved by the cleavage of a peptide bond or bonds within a protein. Protein maturation is the process leading to the attainment of the full functional capacity of a protein.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0032803    regulation of low-density lipoprotein particle receptor catabolic process    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the breakdown of low-density lipoprotein particle receptors.
    GO:0043523    regulation of neuron apoptotic process    Any process that modulates the occurrence or rate of cell death by apoptotic process in neurons.
    GO:0010469    regulation of receptor activity    Any process that modulates the frequency, rate or extent of receptor activity. Receptor activity is when a molecule combines with an extracellular or intracellular messenger to initiate a change in cell activity.
    GO:0008202    steroid metabolic process    The chemical reactions and pathways involving steroids, compounds with a 1,2,cyclopentanoperhydrophenanthrene nucleus.
    GO:0006641    triglyceride metabolic process    The chemical reactions and pathways involving triglyceride, any triester of glycerol. The three fatty acid residues may all be the same or differ in any permutation. Triglycerides are important components of plant oils, animal fats and animal plasma lipoproteins.
cellular component
    GO:0030134    COPII-coated ER to Golgi transport vesicle    A vesicle with a coat formed of the COPII coat complex proteins. The COPII coat complex is formed by the Sec23p/Sec24p and the Sec13p/Sec31p heterodimers. COPII-associated vesicles transport proteins from the rough endoplasmic reticulum to the Golgi apparatus (anterograde transport).
    GO:0005794    Golgi apparatus    A compound membranous cytoplasmic organelle of eukaryotic cells, consisting of flattened, ribosome-free vesicles arranged in a more or less regular stack. The Golgi apparatus differs from the endoplasmic reticulum in often having slightly thicker membranes, appearing in sections as a characteristic shallow semicircle so that the convex side (cis or entry face) abuts the endoplasmic reticulum, secretory vesicles emerging from the concave side (trans or exit face). In vertebrate cells there is usually one such organelle, while in invertebrates and plants, where they are known usually as dictyosomes, there may be several scattered in the cytoplasm. The Golgi apparatus processes proteins produced on the ribosomes of the rough endoplasmic reticulum; such processing includes modification of the core oligosaccharides of glycoproteins, and the sorting and packaging of proteins for transport to a variety of cellular locations. Three different regions of the Golgi are now recognized both in terms of structure and function: cis, in the vicinity of the cis face, trans, in the vicinity of the trans face, and medial, lying between the cis and trans regions.
    GO:1990667    PCSK9-AnxA2 complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and Annexin A2 (AnxA2).
    GO:1990666    PCSK9-LDLR complex    A protein complex consisting of the serine protease PCSK9 (Proprotein convertase subtilisin/kexin-9) and a low-density lipoprotein receptor (LDLR). Interaction typically occurs through the epidermal growth factor-like repeat A (EGF-A) domain of the LDLR, and complex formation promotes degradation of the LDLR through the endosome/lysosome pathway.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005769    early endosome    A membrane-bounded organelle that receives incoming material from primary endocytic vesicles that have been generated by clathrin-dependent and clathrin-independent endocytosis; vesicles fuse with the early endosome to deliver cargo for sorting into recycling or degradation pathways.
    GO:0005783    endoplasmic reticulum    The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
    GO:0005768    endosome    A vacuole to which materials ingested by endocytosis are delivered.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0031232    extrinsic component of external side of plasma membrane    The component of a plasma membrane consisting of gene products and protein complexes that are loosely bound to its external surface, but not integrated into the hydrophobic region.
    GO:0005770    late endosome    A prelysosomal endocytic organelle differentiated from early endosomes by lower lumenal pH and different protein composition. Late endosomes are more spherical than early endosomes and are mostly juxtanuclear, being concentrated near the microtubule organizing center.
    GO:0005764    lysosome    A small lytic vacuole that has cell cycle-independent morphology and is found in most animal cells and that contains a variety of hydrolases, most of which have their maximal activities in the pH range 5-6. The contained enzymes display latency if properly isolated. About 40 different lysosomal hydrolases are known and lysosomes have a great variety of morphologies and functions.
    GO:0048471    perinuclear region of cytoplasm    Cytoplasm situated near, or occurring around, the nucleus.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0005791    rough endoplasmic reticulum    The rough (or granular) endoplasmic reticulum (ER) has ribosomes adhering to the outer surface; the ribosomes are the site of translation of the mRNA for those proteins which are either to be retained within the cisternae (ER-resident proteins), the proteins of the lysosomes, or the proteins destined for export from the cell. Glycoproteins undergo their initial glycosylation within the cisternae.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 3sqo)
 
  Sites
(no "Sites" information available for 3sqo)
 
  Cis Peptide Bonds
    Glu H:152 - Pro H:153   [ RasMol ]  
    Phe H:150 - Pro H:151   [ RasMol ]  
    Ser A:326 - Pro A:327   [ RasMol ]  
    Ser L:7 - Pro L:8   [ RasMol ]  
    Tyr L:140 - Pro L:141   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  3sqo
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PCSK9_HUMAN | Q8NBP7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.4.21.-
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  603776
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PCSK9_HUMAN | Q8NBP7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PCSK9_HUMAN | Q8NBP72p4e 2pmw 2qtw 2w2m 2w2n 2w2o 2w2p 2w2q 2xtj 3bps 3gcw 3gcx 3h42 3m0c 3p5b 3p5c 4k8r 4ne9 4nmx 4ov6

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 3SQO)